Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00109
Gene name
Locationscaffold_01:863707..865685
Strand+
Gene length (bp)1978
Transcript length (bp)1920
Coding sequence length (bp)1920
Protein length (aa) 640

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08118 MDM31_MDM32 Yeast mitochondrial distribution and morphology (MDM) proteins 2.0E-242 112 634

GO

GO Term Description Terminal node
GO:0005743 mitochondrial inner membrane Yes
GO:0000001 mitochondrion inheritance Yes
GO:0007005 mitochondrion organization Yes
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0019866 organelle inner membrane No
GO:0071840 cellular component organization or biogenesis No
GO:0006996 organelle organization No
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:0051640 organelle localization No
GO:0016043 cellular component organization No
GO:0031966 mitochondrial membrane No
GO:0048308 organelle inheritance No
GO:0048311 mitochondrion distribution No
GO:0008150 biological_process No
GO:0016020 membrane No
GO:0051646 mitochondrion localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 158 180 22
2 618 635 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00109
MILRAQTLGGAPDNARQRLTHHLLFLTRRSRCPGVIPPPLWHSQYRLYGDKLRNPSSKPSSSSDQPQGLPLLPDK
LQADEKSSDSRNVDSASIASSVSKYLHLSKIPHRPTKEELLATANGFWERVRVRFKWMSIRSMRPWNADEWGAFV
SWFMLGHLVWILVGTTTFFSIIIFSINTVFAQETLAKWVGDYLTQSAGVTVVFESAIVPKWRNGVIAFRNVYVSR
RPGQVESSVSKGSSDVAAVAAAAQATAAPGAVDDGNYTQFDVTIANVNVTLSFLNWWNGKGFLRDVEVTGVRGVV
DRTSVRWTREQISPLSYRHHHEPGDFEIESFKLEDLLLTVHHPDGFRPFSVSIYSCELPQLRKQWLFYDFLSANH
MSGSFDGSLFTIHPQQAHGIVPGHNKRVIVDKEETSAWKKCSRLRIDGLRISHLNRGVDGPFGWIYEGNVDIVAD
VMFPADSAEGIAKVMTDIYDQLEEVVIFNRGQLSAESRPASLTSRTGPQPVHDPGDSKEEEKPNLEGIRFLIMDL
RIHLNDVKAAVPLFTRDISYVNQALVRPIVAYINAKKTYIPITCRIVKELGDFDGSWTAFDCGLMSDASAETYEA
FAKDVEDQQSRVRRFKKVGFWTLSLAVHALFMGMAGNVV*
Coding >Ophcf2|00109
ATGATACTGCGGGCACAGACACTTGGGGGGGCTCCAGACAACGCACGACAAAGACTCACACATCACCTGCTCTTT
CTGACGAGAAGGTCTCGCTGTCCTGGAGTCATTCCGCCGCCACTGTGGCATTCGCAGTACCGATTGTACGGTGAC
AAGCTGCGGAATCCGTCTTCAAAGCCTTCCTCGTCCTCCGACCAGCCTCAAGGCCTCCCCCTCCTTCCCGACAAG
CTTCAGGCCGATGAAAAGTCGTCGGATAGTCGGAATGTCGACTCCGCGTCCATAGCGTCCTCCGTCTCGAAATAT
CTCCATCTCTCCAAGATTCCGCATCGTCCGACTAAAGAGGAGCTCTTGGCCACTGCCAATGGTTTCTGGGAAAGA
GTCAGAGTTCGATTCAAATGGATGTCCATCAGGAGTATGAGGCCATGGAACGCTGACGAATGGGGAGCTTTCGTA
TCATGGTTCATGCTCGGTCATCTTGTCTGGATATTGGTTGGGACAACTACCTTTTTCTCCATCATCATCTTCTCC
ATCAACACCGTCTTTGCTCAGGAGACTCTCGCGAAATGGGTCGGCGACTACCTGACACAATCTGCCGGCGTCACC
GTCGTCTTCGAGTCTGCCATTGTGCCCAAGTGGCGTAACGGCGTCATCGCTTTCCGCAACGTCTATGTTTCTCGA
AGACCGGGCCAAGTTGAGTCGTCCGTCAGCAAGGGATCATCCGATGTGGCCGCTGTCGCCGCCGCTGCCCAGGCT
ACGGCTGCACCCGGTGCGGTAGATGATGGCAACTACACACAATTCGATGTCACTATTGCCAACGTTAACGTTACG
CTGTCTTTCCTCAACTGGTGGAATGGCAAAGGCTTTCTCAGAGACGTCGAAGTTACGGGCGTCCGAGGAGTAGTA
GACCGGACGTCGGTGCGTTGGACTCGGGAGCAAATCAGTCCCCTTTCGTACCGCCACCATCATGAACCTGGCGAC
TTTGAAATCGAGTCTTTCAAGCTCGAGGACTTGCTGCTGACTGTCCATCACCCTGACGGCTTCCGACCCTTTTCC
GTCAGCATCTACTCATGCGAGCTGCCCCAACTGCGGAAACAGTGGCTATTTTACGACTTTTTGTCGGCTAACCAC
ATGTCGGGCTCGTTTGACGGTTCCCTGTTCACCATCCACCCTCAACAAGCACACGGCATAGTTCCTGGCCACAAC
AAGCGCGTCATTGTGGACAAGGAAGAGACGAGTGCTTGGAAGAAATGCAGCAGGCTCAGGATAGACGGACTGAGG
ATAAGCCACCTTAATCGCGGCGTCGACGGGCCATTCGGCTGGATATATGAGGGCAATGTCGACATTGTGGCGGAC
GTCATGTTCCCGGCCGACAGCGCCGAGGGAATCGCCAAAGTCATGACCGACATCTACGACCAACTCGAGGAAGTG
GTCATCTTCAACAGAGGCCAGCTGTCTGCTGAGTCGAGGCCCGCCTCTCTTACGTCGAGAACAGGTCCTCAACCG
GTCCACGACCCGGGGGATAGCAAGGAGGAAGAGAAGCCAAACCTCGAAGGGATACGATTTCTCATCATGGATCTA
CGAATCCATCTCAACGACGTCAAGGCCGCCGTCCCCCTCTTCACGCGAGATATCTCCTACGTCAACCAGGCCCTG
GTACGGCCCATCGTCGCCTACATTAACGCCAAGAAGACGTATATACCCATCACCTGCCGCATCGTCAAGGAGCTT
GGCGACTTTGACGGCAGCTGGACAGCCTTCGACTGCGGACTCATGAGCGACGCGTCGGCCGAGACGTACGAGGCC
TTTGCAAAGGATGTCGAGGATCAGCAGAGTCGAGTGCGACGCTTCAAGAAGGTTGGTTTCTGGACATTGTCGTTG
GCTGTGCATGCGCTCTTTATGGGCATGGCTGGCAACGTCGTGTAA
Transcript >Ophcf2|00109
ATGATACTGCGGGCACAGACACTTGGGGGGGCTCCAGACAACGCACGACAAAGACTCACACATCACCTGCTCTTT
CTGACGAGAAGGTCTCGCTGTCCTGGAGTCATTCCGCCGCCACTGTGGCATTCGCAGTACCGATTGTACGGTGAC
AAGCTGCGGAATCCGTCTTCAAAGCCTTCCTCGTCCTCCGACCAGCCTCAAGGCCTCCCCCTCCTTCCCGACAAG
CTTCAGGCCGATGAAAAGTCGTCGGATAGTCGGAATGTCGACTCCGCGTCCATAGCGTCCTCCGTCTCGAAATAT
CTCCATCTCTCCAAGATTCCGCATCGTCCGACTAAAGAGGAGCTCTTGGCCACTGCCAATGGTTTCTGGGAAAGA
GTCAGAGTTCGATTCAAATGGATGTCCATCAGGAGTATGAGGCCATGGAACGCTGACGAATGGGGAGCTTTCGTA
TCATGGTTCATGCTCGGTCATCTTGTCTGGATATTGGTTGGGACAACTACCTTTTTCTCCATCATCATCTTCTCC
ATCAACACCGTCTTTGCTCAGGAGACTCTCGCGAAATGGGTCGGCGACTACCTGACACAATCTGCCGGCGTCACC
GTCGTCTTCGAGTCTGCCATTGTGCCCAAGTGGCGTAACGGCGTCATCGCTTTCCGCAACGTCTATGTTTCTCGA
AGACCGGGCCAAGTTGAGTCGTCCGTCAGCAAGGGATCATCCGATGTGGCCGCTGTCGCCGCCGCTGCCCAGGCT
ACGGCTGCACCCGGTGCGGTAGATGATGGCAACTACACACAATTCGATGTCACTATTGCCAACGTTAACGTTACG
CTGTCTTTCCTCAACTGGTGGAATGGCAAAGGCTTTCTCAGAGACGTCGAAGTTACGGGCGTCCGAGGAGTAGTA
GACCGGACGTCGGTGCGTTGGACTCGGGAGCAAATCAGTCCCCTTTCGTACCGCCACCATCATGAACCTGGCGAC
TTTGAAATCGAGTCTTTCAAGCTCGAGGACTTGCTGCTGACTGTCCATCACCCTGACGGCTTCCGACCCTTTTCC
GTCAGCATCTACTCATGCGAGCTGCCCCAACTGCGGAAACAGTGGCTATTTTACGACTTTTTGTCGGCTAACCAC
ATGTCGGGCTCGTTTGACGGTTCCCTGTTCACCATCCACCCTCAACAAGCACACGGCATAGTTCCTGGCCACAAC
AAGCGCGTCATTGTGGACAAGGAAGAGACGAGTGCTTGGAAGAAATGCAGCAGGCTCAGGATAGACGGACTGAGG
ATAAGCCACCTTAATCGCGGCGTCGACGGGCCATTCGGCTGGATATATGAGGGCAATGTCGACATTGTGGCGGAC
GTCATGTTCCCGGCCGACAGCGCCGAGGGAATCGCCAAAGTCATGACCGACATCTACGACCAACTCGAGGAAGTG
GTCATCTTCAACAGAGGCCAGCTGTCTGCTGAGTCGAGGCCCGCCTCTCTTACGTCGAGAACAGGTCCTCAACCG
GTCCACGACCCGGGGGATAGCAAGGAGGAAGAGAAGCCAAACCTCGAAGGGATACGATTTCTCATCATGGATCTA
CGAATCCATCTCAACGACGTCAAGGCCGCCGTCCCCCTCTTCACGCGAGATATCTCCTACGTCAACCAGGCCCTG
GTACGGCCCATCGTCGCCTACATTAACGCCAAGAAGACGTATATACCCATCACCTGCCGCATCGTCAAGGAGCTT
GGCGACTTTGACGGCAGCTGGACAGCCTTCGACTGCGGACTCATGAGCGACGCGTCGGCCGAGACGTACGAGGCC
TTTGCAAAGGATGTCGAGGATCAGCAGAGTCGAGTGCGACGCTTCAAGAAGGTTGGTTTCTGGACATTGTCGTTG
GCTGTGCATGCGCTCTTTATGGGCATGGCTGGCAACGTCGTGTAA
Gene >Ophcf2|00109
ATGATACTGCGGGCACAGACACTTGGGGGGGCTCCAGACAACGCACGACAAAGACTCACACATCACCTGCTCTTT
CTGACGAGAAGGTCTCGCTGTCCTGGAGTCATTCCGCCGCCACTGTGGCATTCGCAGTACCGATTGTACGGTGAC
AAGCTGCGGAATCCGTCTTCAAAGCCTTCCTCGTCCTCCGACCAGCCTCAAGGCCTCCCCCTCCTTCCCGACAAG
CTTCAGGCCGATGAAAAGTCGTCGGATAGTCGGAATGTCGACTCCGCGTCCATAGCGTCCTCCGTCTCGAAATAT
CTCCATCTCTCCAAGATTCCGCATCGTCCGACTAAAGAGGAGCTCTTGGCCACTGCCAATGGTTTCTGGGAAAGA
GTCAGAGTTCGATTCAAATGGATGTCCATCAGGAGTATGAGGCCATGGAACGCTGACGAATGGGGAGCTTTCGTA
TCATGGTTCATGCTCGGTCATCTTGTCTGGATATTGGTTGGGACAACTACCTTTTTCTCCATCATCATCTTCTCC
ATCAACACCGTCTTTGCTCAGGGTAGATGGCGCCCTCTCCCTCATCACGTAACTTGCTATGCATGCTGACACATG
ACCAGAGACTCTCGCGAAATGGGTCGGCGACTACCTGACACAATCTGCCGGCGTCACCGTCGTCTTCGAGTCTGC
CATTGTGCCCAAGTGGCGTAACGGCGTCATCGCTTTCCGCAACGTCTATGTTTCTCGAAGACCGGGCCAAGTTGA
GTCGTCCGTCAGCAAGGGATCATCCGATGTGGCCGCTGTCGCCGCCGCTGCCCAGGCTACGGCTGCACCCGGTGC
GGTAGATGATGGCAACTACACACAATTCGATGTCACTATTGCCAACGTTAACGTTACGCTGTCTTTCCTCAACTG
GTGGAATGGCAAAGGCTTTCTCAGAGACGTCGAAGTTACGGGCGTCCGAGGAGTAGTAGACCGGACGTCGGTGCG
TTGGACTCGGGAGCAAATCAGTCCCCTTTCGTACCGCCACCATCATGAACCTGGCGACTTTGAAATCGAGTCTTT
CAAGCTCGAGGACTTGCTGCTGACTGTCCATCACCCTGACGGCTTCCGACCCTTTTCCGTCAGCATCTACTCATG
CGAGCTGCCCCAACTGCGGAAACAGTGGCTATTTTACGACTTTTTGTCGGCTAACCACATGTCGGGCTCGTTTGA
CGGTTCCCTGTTCACCATCCACCCTCAACAAGCACACGGCATAGTTCCTGGCCACAACAAGCGCGTCATTGTGGA
CAAGGAAGAGACGAGTGCTTGGAAGAAATGCAGCAGGCTCAGGATAGACGGACTGAGGATAAGCCACCTTAATCG
CGGCGTCGACGGGCCATTCGGCTGGATATATGAGGGCAATGTCGACATTGTGGCGGACGTCATGTTCCCGGCCGA
CAGCGCCGAGGGAATCGCCAAAGTCATGACCGACATCTACGACCAACTCGAGGAAGTGGTCATCTTCAACAGAGG
CCAGCTGTCTGCTGAGTCGAGGCCCGCCTCTCTTACGTCGAGAACAGGTCCTCAACCGGTCCACGACCCGGGGGA
TAGCAAGGAGGAAGAGAAGCCAAACCTCGAAGGGATACGATTTCTCATCATGGATCTACGAATCCATCTCAACGA
CGTCAAGGCCGCCGTCCCCCTCTTCACGCGAGATATCTCCTACGTCAACCAGGCCCTGGTACGGCCCATCGTCGC
CTACATTAACGCCAAGAAGACGTATATACCCATCACCTGCCGCATCGTCAAGGAGCTTGGCGACTTTGACGGCAG
CTGGACAGCCTTCGACTGCGGACTCATGAGCGACGCGTCGGCCGAGACGTACGAGGCCTTTGCAAAGGATGTCGA
GGATCAGCAGAGTCGAGTGCGACGCTTCAAGAAGGTTGGTTTCTGGACATTGTCGTTGGCTGTGCATGCGCTCTT
TATGGGCATGGCTGGCAACGTCGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail