Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00107
Gene name
Locationscaffold_01:859570..861628
Strand-
Gene length (bp)2058
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00113 Enolase_C Enolase, C-terminal TIM barrel domain 7.8E-155 181 472
PF03952 Enolase_N Enolase, N-terminal domain 8.4E-56 40 171

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5983 0.3975 0.2538 0.0605 0.396 0.5495 0.1017 0.0889 0.0635 0.0773

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup198
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3243
Ophiocordyceps australis 1348a (Ghana) OphauG2|3244
Ophiocordyceps australis map64 (Brazil) OphauB2|5568
Ophiocordyceps australis map64 (Brazil) OphauB2|5569
Ophiocordyceps camponoti-floridani Ophcf2|00105
Ophiocordyceps camponoti-floridani Ophcf2|00107 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2275
Ophiocordyceps camponoti-rufipedis Ophun1|2276
Ophiocordyceps kimflemingae Ophio5|7488
Ophiocordyceps kimflemingae Ophio5|868
Ophiocordyceps subramaniannii Hirsu2|8357
Ophiocordyceps subramaniannii Hirsu2|8359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00107
MACILYYESPTFDRSFAFQALHQLIHKPQTSQHPSLNMAITKVHARSVYDSRGNPTVEVDLVTETGLHRAIVPSG
ASTGQHEACELRDGDKSKWGGKGVGKAVENVNSIIGPALIKEGIDVKDQSKVDKFLNGLDGTANKTKLGANAILG
VSLAVAKAGAAEKGVPLYAHISDLAGTKKPYVMPVPFMNVVNGGSHAGGRLAFQEFMIAPCDAPSFSEAMRQGAE
VYQQLKSLAKKKYGQSAGNVGDEGGVAPDIQTAVEALDLITEAIDKAGYTGKMKIAMDVASSEFYKEKEKKYDLD
FKNPQSDPSKWITYQELAAMYSDLCKKYPIVSIEDPFAEDDWEAWSYFYKSQDIQIVGDDLTVTNPLRIKKAIQD
KACNALLLKVNQIGTLTESIQAAKDSYADGWGVMVSHRSGETEDVTIADIVVGIRSGEIKTGAPCRSERLAKLNQ
ILRIEEELGDKAIYAGASFRKAVNM*
Coding >Ophcf2|00107
ATGGCATGCATACTCTACTACGAAAGCCCCACCTTCGATCGCAGCTTCGCATTCCAAGCTCTCCATCAGCTGATA
CATAAGCCGCAAACGTCTCAGCACCCTTCTCTCAATATGGCCATCACAAAGGTCCACGCACGCTCTGTCTATGAC
TCTCGTGGCAATCCCACCGTCGAGGTCGATCTGGTCACGGAGACCGGCCTTCACCGAGCTATTGTCCCGTCTGGG
GCTTCTACCGGCCAGCACGAAGCTTGCGAGCTCAGAGATGGCGACAAGTCCAAATGGGGCGGCAAGGGTGTCGGC
AAGGCCGTCGAAAACGTCAACTCCATCATCGGCCCTGCTCTGATCAAGGAGGGCATCGACGTCAAGGACCAGTCC
AAAGTCGACAAGTTCCTCAACGGCCTCGACGGAACTGCCAACAAGACCAAGCTCGGTGCCAACGCCATCCTCGGT
GTGAGCTTGGCTGTTGCCAAGGCTGGCGCAGCGGAAAAGGGCGTGCCTCTTTACGCTCACATCTCGGACTTGGCT
GGGACCAAGAAGCCCTACGTCATGCCTGTTCCATTTATGAACGTTGTCAACGGAGGATCACACGCTGGTGGCCGT
CTTGCCTTTCAGGAGTTCATGATCGCGCCTTGCGATGCTCCTTCATTCTCCGAGGCCATGCGTCAGGGCGCCGAG
GTTTACCAACAGTTGAAGAGCTTGGCCAAGAAGAAGTATGGCCAATCCGCCGGCAACGTCGGCGACGAGGGCGGT
GTTGCACCTGATATCCAGACGGCTGTCGAGGCCTTGGATCTCATCACCGAAGCCATTGACAAGGCCGGCTATACT
GGCAAGATGAAGATCGCAATGGATGTTGCCTCGAGCGAATTTTACAAGGAGAAGGAGAAGAAGTACGATCTCGAC
TTCAAGAACCCTCAAAGCGACCCCAGCAAGTGGATCACCTATCAAGAGCTTGCTGCCATGTACTCGGACTTGTGC
AAGAAGTATCCCATCGTTTCCATCGAGGATCCTTTCGCCGAGGACGACTGGGAGGCCTGGAGCTACTTCTACAAG
TCGCAGGATATCCAGATCGTGGGTGACGACTTGACTGTCACCAACCCTCTTCGCATCAAAAAGGCCATTCAAGAC
AAGGCGTGCAACGCGCTCCTCCTCAAGGTCAACCAGATTGGTACATTGACCGAGTCTATCCAGGCTGCCAAGGAC
TCGTACGCCGACGGTTGGGGCGTCATGGTGTCTCATCGGTCGGGCGAGACTGAAGACGTGACCATTGCCGATATC
GTGGTTGGCATCAGGTCGGGCGAGATCAAGACGGGTGCGCCCTGCCGGTCCGAGCGTCTGGCCAAACTCAACCAG
ATTCTCCGCATCGAGGAGGAGCTCGGTGATAAGGCCATTTACGCCGGTGCCAGCTTCCGCAAGGCTGTTAACATG
TGA
Transcript >Ophcf2|00107
ATGGCATGCATACTCTACTACGAAAGCCCCACCTTCGATCGCAGCTTCGCATTCCAAGCTCTCCATCAGCTGATA
CATAAGCCGCAAACGTCTCAGCACCCTTCTCTCAATATGGCCATCACAAAGGTCCACGCACGCTCTGTCTATGAC
TCTCGTGGCAATCCCACCGTCGAGGTCGATCTGGTCACGGAGACCGGCCTTCACCGAGCTATTGTCCCGTCTGGG
GCTTCTACCGGCCAGCACGAAGCTTGCGAGCTCAGAGATGGCGACAAGTCCAAATGGGGCGGCAAGGGTGTCGGC
AAGGCCGTCGAAAACGTCAACTCCATCATCGGCCCTGCTCTGATCAAGGAGGGCATCGACGTCAAGGACCAGTCC
AAAGTCGACAAGTTCCTCAACGGCCTCGACGGAACTGCCAACAAGACCAAGCTCGGTGCCAACGCCATCCTCGGT
GTGAGCTTGGCTGTTGCCAAGGCTGGCGCAGCGGAAAAGGGCGTGCCTCTTTACGCTCACATCTCGGACTTGGCT
GGGACCAAGAAGCCCTACGTCATGCCTGTTCCATTTATGAACGTTGTCAACGGAGGATCACACGCTGGTGGCCGT
CTTGCCTTTCAGGAGTTCATGATCGCGCCTTGCGATGCTCCTTCATTCTCCGAGGCCATGCGTCAGGGCGCCGAG
GTTTACCAACAGTTGAAGAGCTTGGCCAAGAAGAAGTATGGCCAATCCGCCGGCAACGTCGGCGACGAGGGCGGT
GTTGCACCTGATATCCAGACGGCTGTCGAGGCCTTGGATCTCATCACCGAAGCCATTGACAAGGCCGGCTATACT
GGCAAGATGAAGATCGCAATGGATGTTGCCTCGAGCGAATTTTACAAGGAGAAGGAGAAGAAGTACGATCTCGAC
TTCAAGAACCCTCAAAGCGACCCCAGCAAGTGGATCACCTATCAAGAGCTTGCTGCCATGTACTCGGACTTGTGC
AAGAAGTATCCCATCGTTTCCATCGAGGATCCTTTCGCCGAGGACGACTGGGAGGCCTGGAGCTACTTCTACAAG
TCGCAGGATATCCAGATCGTGGGTGACGACTTGACTGTCACCAACCCTCTTCGCATCAAAAAGGCCATTCAAGAC
AAGGCGTGCAACGCGCTCCTCCTCAAGGTCAACCAGATTGGTACATTGACCGAGTCTATCCAGGCTGCCAAGGAC
TCGTACGCCGACGGTTGGGGCGTCATGGTGTCTCATCGGTCGGGCGAGACTGAAGACGTGACCATTGCCGATATC
GTGGTTGGCATCAGGTCGGGCGAGATCAAGACGGGTGCGCCCTGCCGGTCCGAGCGTCTGGCCAAACTCAACCAG
ATTCTCCGCATCGAGGAGGAGCTCGGTGATAAGGCCATTTACGCCGGTGCCAGCTTCCGCAAGGCTGTTAACATG
TGA
Gene >Ophcf2|00107
ATGGCATGCATACTCTACTACGAAAGCCCCACCTTCGGTATCAAGCTGTTGTGACTTGACTAAGAAAGATGGAGA
CAATAAAAATCTAAAAGCTGTTTCGAGTTTCACCTTTTTCTCCTTACGATCTCTCAATTGAACTGCTCCCGCAAA
AACATCATCCATCAGATCGCAGCTTCGCATTCCAAGCTCTCCATGTAAGTCGTATCCGAGGCCAATCAGAGGGTC
TCTTCGTCGTAACCTTGCAGCCCCTTCCTCTACATACATACATATGTTATGTGTACGAATATTCCTACATACTGC
TACCCCTCCCCCTCTCATCCCATCCTTTCGTCACCTTGCTTGCTGCCCCGCAGGCCAGCTCTAGCAAAGTCTACT
CGGCCAAGCTCATCATCACCATTCTGTCAAGTCTCCCACGCAGTTTCGCCATCGCCTACCGCCTTCCATCTTCCT
GACTTGGCAGTCTGTCTCTGACAAGGATCTAGCAGCTGATACATAAGCCGCAAACGTCTCAGCACCCTTCTCTCA
ATATGGCCATCACAAAGGTCCACGCACGCTCTGTCTATGACTCTCGTGGCAATCCCACCGTCGAGGTCGATCTGG
TCACGGAGACCGGCCTTCACCGAGCTATTGTCCCGTCTGGGGCTTCTACCGGTTCGCCTCTTCCGAGACAAGCCT
CGTAGATTCGGGCGTGTGATAACAGGGTACGCAGGCCAGCACGAAGCTTGCGAGCTCAGAGATGGCGACAAGTCC
AAATGGGGCGGCAAGGGTGTCGGCAAGGCCGTCGAAAACGTCAACTCCATCATCGGCCCTGCTCTGATCAAGGAG
GGCATCGACGTCAAGGACCAGTCCAAAGTCGACAAGTTCCTCAACGGCCTCGACGGAACTGCCAACAAGACCAAG
CTCGGTGCCAACGCCATCCTCGGTGTGAGCTTGGCTGTTGCCAAGGCTGGCGCAGCGGAAAAGGTAGACTTGATC
AGCTTCGTCGCCATCGGTTCCCACTGACGATGCTAGGGCGTGCCTCTTTACGCTCACATCTCGGACTTGGCTGGG
ACCAAGAAGCCCTACGTCATGCCTGTTCCATTTATGAACGTTGTCAACGGAGGGTGAGAGGCGTGCTCCCGGTGC
CATGGATTTCCCCCTGTGTACTGACTTGATGGTAAGATCACACGCTGGTGGCCGTCTTGCCTTTCAGGAGTTCAT
GATCGCGCCTTGGTAAGCACTCGCCTCAGAGTAAGTCCCGAGTTGCTTTTGACAGTCTACAGCGATGCTCCTTCA
TTCTCCGAGGCCATGCGTCAGGGCGCCGAGGTTTACCAACAGTTGAAGAGCTTGGCCAAGAAGAAGTATGGCCAA
TCCGCCGGCAACGTCGGCGACGAGGGCGGTGTTGCACCTGATATCCAGACGGCTGTCGAGGCCTTGGATCTCATC
ACCGAAGCCATTGACAAGGCCGGCTATACTGGCAAGATGAAGATCGCAATGGATGTTGCCTCGAGCGAATTTTAC
AAGGAGAAGGAGAAGAAGTACGATCTCGACTTCAAGAACCCTCAAAGCGACCCCAGCAAGTGGATCACCTATCAA
GAGCTTGCTGCCATGTACTCGGACTTGTGCAAGAAGTATCCCATCGTTTCCATCGAGGATCCTTTCGCCGAGGAC
GACTGGGAGGCCTGGAGCTACTTCTACAAGTCGCAGGATATCCAGATCGTGGGTGACGACTTGACTGTCACCAAC
CCTCTTCGCATCAAAAAGGCCATTCAAGACAAGGCGTGCAACGCGCTCCTCCTCAAGGTCAACCAGATTGGTACA
TTGACCGAGTCTATCCAGGCTGCCAAGGACTCGTACGCCGACGGTTGGGGCGTCATGGTGTCTCATCGGTCGGGC
GAGACTGAAGACGTGACCATTGCCGATATCGTGGTTGGCATCAGGTCGGGCGAGATCAAGACGGGTGCGCCCTGC
CGGTCCGAGCGTCTGGCCAAACTCAACCAGATTCTCCGCATCGAGGAGGAGCTCGGTGATAAGGCCATTTACGCC
GGTGCCAGCTTCCGCAAGGCTGTTAACATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail