Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00101
Gene name
Locationscaffold_01:848199..848737
Strand+
Gene length (bp)538
Transcript length (bp)414
Coding sequence length (bp)414
Protein length (aa) 138

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13233 Complex1_LYR_2 Complex1_LYR-like 6.0E-17 42 115
PF05347 Complex1_LYR Complex 1 protein (LYR family) 2.0E-09 42 93

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1743 0.1494 0.0515 0.0666 0.9794 0.0346 0.0342 0.0444 0.0476 0.098

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6532
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|5560
Ophiocordyceps camponoti-floridani Ophcf2|00101 (this protein)
Ophiocordyceps kimflemingae Ophio5|397
Ophiocordyceps subramaniannii Hirsu2|1575

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00101
MRAQQGLIGIVPRNSYKMLWHISRATQRCLHVSSTALLPPKVLYRRVLRAHRKHLPAQSRQLGDNYVKSEFRLHR
NVDNPAQLIGFLTEWQLYAQKVEENSWAGDKLDQNFFDKMNEEQQQQVSRLLHANQKRNGSA*
Coding >Ophcf2|00101
ATGCGGGCACAACAAGGCTTAATCGGAATCGTCCCTCGTAACAGTTACAAGATGCTATGGCATATCTCTAGAGCG
ACGCAGCGATGTCTGCACGTCTCCTCCACGGCATTACTCCCGCCCAAAGTCCTTTACCGACGCGTACTTCGAGCG
CATCGGAAACATCTACCAGCCCAGTCGCGTCAACTAGGCGACAACTACGTCAAGTCGGAATTCCGCTTGCATCGG
AATGTCGATAACCCGGCTCAACTGATTGGCTTCCTCACGGAATGGCAGCTCTACGCCCAAAAGGTGGAAGAGAAC
TCGTGGGCGGGCGATAAGCTCGACCAAAACTTCTTTGACAAGATGAACGAGGAGCAGCAGCAGCAGGTCTCCAGG
TTATTACACGCGAATCAGAAGCGAAATGGATCTGCATAG
Transcript >Ophcf2|00101
ATGCGGGCACAACAAGGCTTAATCGGAATCGTCCCTCGTAACAGTTACAAGATGCTATGGCATATCTCTAGAGCG
ACGCAGCGATGTCTGCACGTCTCCTCCACGGCATTACTCCCGCCCAAAGTCCTTTACCGACGCGTACTTCGAGCG
CATCGGAAACATCTACCAGCCCAGTCGCGTCAACTAGGCGACAACTACGTCAAGTCGGAATTCCGCTTGCATCGG
AATGTCGATAACCCGGCTCAACTGATTGGCTTCCTCACGGAATGGCAGCTCTACGCCCAAAAGGTGGAAGAGAAC
TCGTGGGCGGGCGATAAGCTCGACCAAAACTTCTTTGACAAGATGAACGAGGAGCAGCAGCAGCAGGTCTCCAGG
TTATTACACGCGAATCAGAAGCGAAATGGATCTGCATAG
Gene >Ophcf2|00101
ATGCGGGCACAACAAGGCTTAATCGGAATCGTCCCTCGTAACAGTTACAAGATGCTATGGCATATCTCTAGAGCG
ACGCAGCGATGTCTGCACGTCTCCTCCACGGCATTACTCCCGCCCAAAGTCCTTTACCGACGCGTACTTCGAGCG
CATCGGAAACATCTACCAGCCCAGTCGCGTCAACTAGGCGACAACTACGTCAAGTCGGAATTCCGCTTGCATCGG
AATGTCGATAACCCGGCTCAACTGGTAGGTCGCTGCCCGTCAAGCCGTGGTAATCTTACCTTTTGACAAGGCGAG
TATCCGTCTGCCAGATTGGCTTCCTCACGGAATGGCAGCTCTACGCCCAAAAGGTGGAAGAGAACTCGTGGGCGG
GCGATAAGCTCGACCAAAACTTCTTTGACAAGATGAACGGTGAGTCGCGACGTCTGTTCGAATTGCCGGTTGGGA
AATACGAGGCTTATTGGCAGCAGAGGAGCAGCAGCAGCAGGTCTCCAGGTTATTACACGCGAATCAGAAGCGAAA
TGGATCTGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail