Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00099
Gene name
Locationscaffold_01:842072..844574
Strand+
Gene length (bp)2502
Transcript length (bp)1995
Coding sequence length (bp)1995
Protein length (aa) 665

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08457 Sfi1 Sfi1 spindle body protein 6.1E-18 275 503

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5968 0.6214 0.0499 0.0773 0.5552 0.0762 0.0237 0.0314 0.1112 0.1091

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5279
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5772
Ophiocordyceps australis map64 (Brazil) OphauB2|8169
Ophiocordyceps camponoti-floridani Ophcf2|00099 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|187
Ophiocordyceps kimflemingae Ophio5|4549
Ophiocordyceps subramaniannii Hirsu2|4658

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00099
MPRHNVPPQLPRCSLGNGSYYSNQDITILHSVVVAAQEELDHASEPKPLPAAVLFRAYDDVLPVYGVDPDLDHHL
SALVFRIGGEQGHGTLLSKFQAILGRMGIVLEFGDDTPSPEASPVFFPSPTSSFRSRLNFDVERIMSESNLNNGS
DVTTAALSSADHVLQPGGEIFPEENTEIADTPVGTAMDLKSESKDAGKTSSLDGRRSALAAAFDLWRSRAAANLR
QIEGLHDDRPMHNRWAPKESNNGPAEIPGQLKRDDGFYALSDDIITLSQEHHLVQCASRARQIYLASKILNHWAD
RTAIRLEREAVARRHMIRFRCFRAWSQAPSSRLPAVDRLRASTAVQKLQRAVAYHRSGLSQSASSTAEARSAGLV
QQALARWQCRISAHNSLCTSIKRTKLDTASRWREDAWGTQALGHAATAHCADWQSHMAMQKWRARADKSKLSQKV
AHHIRTLCLYSNCLDTWSDCAEVKQRSSTYRQRLYLDRAAFAFYVWNLSARAQAVRWRREFLLVESAFNAWSSGA
ARNTGARSAAHQHHVLDSKTRVCRRLKRLQSERANLTRLHSRAQLYLHGTRLLKVFDLTVRLRKDRTKSRIRRHL
MMRYTQISSSRKKRTFLAALDRWKLASERDSRMAQTAQEFDFRRLAAAVQDRKPIPDKVAGKMG*
Coding >Ophcf2|00099
ATGCCTCGACATAACGTGCCTCCTCAATTGCCCAGATGCAGCCTCGGAAATGGCTCCTATTACTCGAATCAAGAC
ATCACCATCTTGCACTCCGTCGTCGTAGCTGCTCAAGAAGAGCTCGATCATGCATCCGAACCGAAGCCACTACCT
GCGGCGGTATTATTCAGAGCTTACGACGATGTCCTTCCAGTATATGGCGTCGATCCGGACCTTGATCACCACCTG
TCTGCTTTAGTATTCCGCATCGGAGGCGAACAAGGCCATGGCACCTTGCTATCTAAGTTCCAGGCCATCTTAGGT
CGGATGGGCATTGTTCTAGAGTTTGGAGATGATACCCCTTCACCTGAGGCGTCGCCCGTCTTTTTCCCCTCTCCT
ACCTCTTCCTTTCGCAGCCGGCTCAACTTCGATGTCGAGCGCATCATGTCAGAAAGCAACTTGAACAACGGCAGC
GACGTGACCACGGCTGCGTTGTCCTCGGCCGACCATGTACTGCAACCCGGAGGTGAAATCTTCCCTGAGGAGAAC
ACCGAGATTGCAGATACTCCTGTGGGGACTGCCATGGACCTCAAGAGCGAATCCAAGGACGCAGGAAAGACATCA
TCGCTAGACGGACGGCGGTCTGCTCTAGCGGCTGCTTTCGATCTGTGGCGCTCCCGTGCTGCAGCAAATCTTCGG
CAGATTGAGGGGCTTCACGACGATCGACCGATGCATAATCGATGGGCCCCGAAGGAATCTAACAATGGACCCGCG
GAGATTCCTGGACAGCTCAAAAGAGACGATGGATTTTATGCGCTTAGCGACGACATCATCACGCTGTCGCAAGAA
CATCACCTTGTGCAGTGCGCTTCAAGAGCTCGTCAGATATATCTAGCCAGCAAGATCCTCAACCATTGGGCCGAC
CGGACTGCCATCAGACTCGAGCGTGAAGCCGTGGCCAGGAGACATATGATACGGTTTCGTTGTTTTCGAGCCTGG
AGCCAGGCTCCGAGCTCAAGACTTCCTGCTGTCGACAGACTTCGGGCTTCAACAGCGGTCCAAAAGCTCCAACGC
GCCGTTGCGTATCACCGCTCAGGGCTCAGTCAATCCGCGTCTTCTACAGCCGAAGCACGCAGTGCCGGCCTGGTA
CAGCAAGCCCTTGCGAGATGGCAATGCCGAATCTCTGCGCACAACTCCCTCTGCACATCCATTAAGAGGACCAAG
CTCGATACGGCTTCGCGTTGGCGCGAGGATGCGTGGGGAACGCAGGCCTTGGGACACGCTGCAACTGCGCATTGT
GCTGATTGGCAAAGTCACATGGCCATGCAAAAATGGCGGGCTCGGGCTGATAAGAGCAAGCTATCTCAAAAGGTC
GCTCATCACATCAGAACGCTCTGTCTCTATTCGAATTGCCTAGACACCTGGTCTGATTGCGCCGAAGTCAAGCAG
CGAAGCTCTACATATCGGCAACGTCTTTACCTGGACAGGGCAGCCTTTGCCTTTTACGTCTGGAACTTGAGTGCG
AGGGCGCAAGCCGTCCGTTGGAGACGCGAGTTTCTACTGGTTGAGAGCGCTTTCAACGCCTGGTCCAGCGGTGCG
GCGCGAAACACCGGAGCGAGAAGCGCAGCGCATCAGCATCACGTCCTGGACTCGAAGACCAGGGTCTGCAGACGG
CTGAAGCGACTCCAAAGCGAGCGCGCCAACCTCACGCGTTTACACAGCCGGGCCCAATTGTATCTTCACGGCACG
CGCCTGCTGAAGGTCTTTGACTTGACGGTTCGGCTGCGCAAGGACAGGACGAAAAGCCGGATCCGGAGACATCTT
ATGATGAGGTATACTCAGATATCGTCAAGCCGGAAGAAGCGTACCTTCCTGGCCGCCTTGGATCGTTGGAAGCTT
GCATCAGAGCGCGATTCTCGAATGGCGCAGACGGCGCAAGAATTTGACTTCCGACGACTTGCGGCTGCAGTGCAG
GACCGAAAGCCGATACCGGACAAGGTGGCTGGAAAGATGGGATGA
Transcript >Ophcf2|00099
ATGCCTCGACATAACGTGCCTCCTCAATTGCCCAGATGCAGCCTCGGAAATGGCTCCTATTACTCGAATCAAGAC
ATCACCATCTTGCACTCCGTCGTCGTAGCTGCTCAAGAAGAGCTCGATCATGCATCCGAACCGAAGCCACTACCT
GCGGCGGTATTATTCAGAGCTTACGACGATGTCCTTCCAGTATATGGCGTCGATCCGGACCTTGATCACCACCTG
TCTGCTTTAGTATTCCGCATCGGAGGCGAACAAGGCCATGGCACCTTGCTATCTAAGTTCCAGGCCATCTTAGGT
CGGATGGGCATTGTTCTAGAGTTTGGAGATGATACCCCTTCACCTGAGGCGTCGCCCGTCTTTTTCCCCTCTCCT
ACCTCTTCCTTTCGCAGCCGGCTCAACTTCGATGTCGAGCGCATCATGTCAGAAAGCAACTTGAACAACGGCAGC
GACGTGACCACGGCTGCGTTGTCCTCGGCCGACCATGTACTGCAACCCGGAGGTGAAATCTTCCCTGAGGAGAAC
ACCGAGATTGCAGATACTCCTGTGGGGACTGCCATGGACCTCAAGAGCGAATCCAAGGACGCAGGAAAGACATCA
TCGCTAGACGGACGGCGGTCTGCTCTAGCGGCTGCTTTCGATCTGTGGCGCTCCCGTGCTGCAGCAAATCTTCGG
CAGATTGAGGGGCTTCACGACGATCGACCGATGCATAATCGATGGGCCCCGAAGGAATCTAACAATGGACCCGCG
GAGATTCCTGGACAGCTCAAAAGAGACGATGGATTTTATGCGCTTAGCGACGACATCATCACGCTGTCGCAAGAA
CATCACCTTGTGCAGTGCGCTTCAAGAGCTCGTCAGATATATCTAGCCAGCAAGATCCTCAACCATTGGGCCGAC
CGGACTGCCATCAGACTCGAGCGTGAAGCCGTGGCCAGGAGACATATGATACGGTTTCGTTGTTTTCGAGCCTGG
AGCCAGGCTCCGAGCTCAAGACTTCCTGCTGTCGACAGACTTCGGGCTTCAACAGCGGTCCAAAAGCTCCAACGC
GCCGTTGCGTATCACCGCTCAGGGCTCAGTCAATCCGCGTCTTCTACAGCCGAAGCACGCAGTGCCGGCCTGGTA
CAGCAAGCCCTTGCGAGATGGCAATGCCGAATCTCTGCGCACAACTCCCTCTGCACATCCATTAAGAGGACCAAG
CTCGATACGGCTTCGCGTTGGCGCGAGGATGCGTGGGGAACGCAGGCCTTGGGACACGCTGCAACTGCGCATTGT
GCTGATTGGCAAAGTCACATGGCCATGCAAAAATGGCGGGCTCGGGCTGATAAGAGCAAGCTATCTCAAAAGGTC
GCTCATCACATCAGAACGCTCTGTCTCTATTCGAATTGCCTAGACACCTGGTCTGATTGCGCCGAAGTCAAGCAG
CGAAGCTCTACATATCGGCAACGTCTTTACCTGGACAGGGCAGCCTTTGCCTTTTACGTCTGGAACTTGAGTGCG
AGGGCGCAAGCCGTCCGTTGGAGACGCGAGTTTCTACTGGTTGAGAGCGCTTTCAACGCCTGGTCCAGCGGTGCG
GCGCGAAACACCGGAGCGAGAAGCGCAGCGCATCAGCATCACGTCCTGGACTCGAAGACCAGGGTCTGCAGACGG
CTGAAGCGACTCCAAAGCGAGCGCGCCAACCTCACGCGTTTACACAGCCGGGCCCAATTGTATCTTCACGGCACG
CGCCTGCTGAAGGTCTTTGACTTGACGGTTCGGCTGCGCAAGGACAGGACGAAAAGCCGGATCCGGAGACATCTT
ATGATGAGGTATACTCAGATATCGTCAAGCCGGAAGAAGCGTACCTTCCTGGCCGCCTTGGATCGTTGGAAGCTT
GCATCAGAGCGCGATTCTCGAATGGCGCAGACGGCGCAAGAATTTGACTTCCGACGACTTGCGGCTGCAGTGCAG
GACCGAAAGCCGATACCGGACAAGGTGGCTGGAAAGATGGGATGA
Gene >Ophcf2|00099
ATGCCTCGACATAACGTGGTGAGACAGCATCCTTCAAGCTTTAAACCGCTTCCCCGAACTAACAGGCCTCTGCCA
CGATGACAGCCTCCTCAATTGCCCAGATGCAGCCGTCTTCGAAGCAAGCATCCGAAAGTAATGATCGCCTGAATT
CTACGTTGAACGGAGTCGGAAATGGCTCCTATTACTCGAATCAAGGTCTTAAAGCGGACCCCTTTCTCGACTGTC
AGTTATGCGCTGACAGACACCTCACAGACATCACCATCTTGCACTCCGTCGTCGTAGCTGCTCAAGAAGAGCTCG
ATCATGCATCCGAACCGAAGCCACTACCTGCGGCGGTATTATTCAGAGCTTACGACGATGTCCTTCCAGTATATG
GCGTCGATCCGGACCTTGATCACCACCTGTCTGCTTTAGTATTCCGCATCGGAGGCGAACAAGGCCATGGCACCT
TGCTATCTAAGTTCCAGGCCATCTTAGGTCGGATGGGCATTGTTCTAGAGTTTGGAGATGATACCCCTTCACCTG
AGGCGTCGCCCGTCTTTTTCCCCTCTCCTACCTCTTCCTTTCGCAGCCGGCTCAACTTCGATGTCGAGCGCATCA
TGTCAGAAAGCAACTTGAACAACGGCAGCGACGTGACCACGGCTGCGTTGTCCTCGGCCGACCATGTACTGCAAC
CCGGAGGTGAAATCTTCCCTGAGGAGAACACCGAGATTGCAGATACTCCTGTGGGGACTGCCATGGACCTCAAGA
GCGTTCGTGATGATGCACGTGGTGATGTAAGGGGAAATCCATCTCGACGTTTCTCTAATGATGAGGAATCCAAGG
TTAGTTAAAGCTCATTGATTTTGTTTCAAGTCTGACGCATGGCACACTGCCGAATCAGGACGCAGGAAAGACATC
ATCGCTAGACGGACGGCGGTCTGCTCTAGCGGCTGCTTTCGATCTGTGGCGCTCCCGTGCTGCAGCAAATCTTCG
GCAGATTGAGGGGCTTCACGACGATCGACCGATGCATAATCGATGGGCCCCGAAGGGTGAGAGTCTTGCTCGCCT
GCATCAGAAAACTGCGAGAACGGCGTCGAAAATACCTCATTATGGGCCCGCGCAAGATTTGATTGACACGAAGGA
AGGGGAGTTGCATCGTTTCCGTGCAGAGGAGTCATGCGCGCCATCACTGGTGTCAGAATCTAACAATGGACCCGC
GGAGATTCCTGGACAGCTCAAAAGAGACGATGGATTTTATGCGCTTAGCGACGACATCATCACGCTGTCGCAAGA
ACATCACCTTGTGCAGTGCGCTTCAAGAGCTCGTCAGATATATCTAGCCAGCAAGATCCTCAACCATTGGGCCGA
CCGGACTGCCATCAGACTCGAGCGTGAAGCCGTGGCCAGGAGACATATGATACGGTTTCGTTGTTTTCGAGCCTG
GAGCCAGGCTCCGAGCTCAAGACTTCCTGCTGTCGACAGACTTCGGGCTTCAACAGCGGTCCAAAAGCTCCAACG
CGCCGTTGCGTATCACCGCTCAGGGCTCAGTCAATCCGCGTCTTCTACAGCCGAAGCACGCAGTGCCGGCCTGGT
ACAGCAAGCCCTTGCGAGATGGCAATGCCGAATCTCTGCGCACAACTCCCTCTGCACATCCATTAAGAGGACCAA
GCTCGATACGGCTTCGCGTTGGCGCGAGGATGCGTGGGGAACGCAGGCCTTGGGACACGCTGCAACTGCGCATTG
TGCTGATTGGCAAAGTCACATGGCCATGCAAAAATGGCGGGCTCGGGCTGATAAGAGCAAGCTATCTCAAAAGGT
CGCTCATCACATCAGAACGCTCTGTCTCTATTCGAATTGCCTAGACACCTGGTCTGATTGCGCCGAAGTCAAGCA
GCGAAGCTCTACATATCGGCAACGTCTTTACCTGGACAGGGCAGCCTTTGCCTTTTACGTCTGGAACTTGAGTGC
GAGGGCGCAAGCCGTCCGTTGGAGACGCGAGTTTCTACTGGTTGAGAGCGCTTTCAACGCCTGGTCCAGCGGTGC
GGCGCGAAACACCGGAGCGAGAAGCGCAGCGCATCAGCATCACGTCCTGGACTCGAAGACCAGGGTCTGCAGACG
GCTGAAGCGACTCCAAAGCGAGCGCGCCAACCTCACGCGTTTACACAGCCGGGCCCAATTGTATCTTCACGGCAC
GCGCCTGCTGAAGGTCTTTGACTTGACGGTTCGGCTGCGCAAGGACAGGACGAAAAGCCGGATCCGGAGACATCT
TATGATGAGGTATACTCAGATATCGTCAAGCCGGAAGAAGCGTACCTTCCTGGCCGCCTTGGATCGTTGGAAGCT
TGCATCAGAGCGCGATTCTCGAATGGCGCAGACGGCGCAAGAAGTTGGTTCCGTCGATGAGGCTGATAGATGCTC
CTCGGCCCTTGCAGACTGGTATAGTTTGACTTCCGACGACTTGCGGCTGCAGTGCAGGACCGAAAGCCGATACCG
GACAAGGTGGCTGGAAAGATGGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail