Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00097
Gene name
Locationscaffold_01:839581..840211
Strand-
Gene length (bp)630
Transcript length (bp)570
Coding sequence length (bp)570
Protein length (aa) 190

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

Domain # Start End Length
1 92 109 17
2 116 138 22
3 142 164 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 65.58 31.62 99.54
Alive In ants, during behavior modification 104.95 55.16 154.74
Dead In ants, recently dead 110.94 59.37 162.50

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.024074 yes
Alive Dead 0.793999 no
Dead Fungus 0.009988 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00097
MDFAPYQSSPPEHARVASPESLTSPRPSQDATRRSPPLLQHPQPQRAWAGALDGHATAVQGGGGSWANEAQPGPD
PVSEFDTSLGIRLDYEASLAYVALPPLGAIVLLVLERNSDYVRFHAWQAALLFTAILVLHIVISPSSFLSWLLFF
ADVGLMAFLALKAYRDAENLDRFEVPFFGPVSGRILDDE*
Coding >Ophcf2|00097
ATGGACTTTGCTCCTTATCAATCTTCGCCTCCAGAACACGCGCGCGTCGCGTCACCTGAGTCCCTCACGTCACCT
CGCCCATCCCAAGACGCCACCCGCAGAAGCCCCCCCTTGCTGCAGCACCCGCAGCCCCAGCGCGCCTGGGCCGGA
GCTCTAGACGGTCATGCCACCGCTGTTCAAGGCGGTGGAGGCTCGTGGGCCAACGAAGCGCAGCCGGGACCAGAT
CCTGTGAGCGAGTTCGACACGAGCCTCGGCATACGGCTCGATTACGAGGCCTCTCTAGCTTACGTCGCGCTTCCG
CCGCTGGGAGCCATTGTTCTTTTAGTTCTCGAGCGCAATAGCGACTACGTGCGCTTCCACGCCTGGCAGGCCGCC
CTGCTCTTCACCGCCATCCTCGTTCTGCACATCGTCATCTCGCCATCTTCCTTTCTCAGCTGGCTCCTCTTCTTC
GCTGACGTTGGTCTCATGGCGTTCCTCGCCCTCAAGGCATATAGGGACGCTGAGAATCTCGATCGGTTCGAGGTT
CCCTTCTTCGGCCCCGTCTCCGGCCGCATCCTAGATGATGAGTAG
Transcript >Ophcf2|00097
ATGGACTTTGCTCCTTATCAATCTTCGCCTCCAGAACACGCGCGCGTCGCGTCACCTGAGTCCCTCACGTCACCT
CGCCCATCCCAAGACGCCACCCGCAGAAGCCCCCCCTTGCTGCAGCACCCGCAGCCCCAGCGCGCCTGGGCCGGA
GCTCTAGACGGTCATGCCACCGCTGTTCAAGGCGGTGGAGGCTCGTGGGCCAACGAAGCGCAGCCGGGACCAGAT
CCTGTGAGCGAGTTCGACACGAGCCTCGGCATACGGCTCGATTACGAGGCCTCTCTAGCTTACGTCGCGCTTCCG
CCGCTGGGAGCCATTGTTCTTTTAGTTCTCGAGCGCAATAGCGACTACGTGCGCTTCCACGCCTGGCAGGCCGCC
CTGCTCTTCACCGCCATCCTCGTTCTGCACATCGTCATCTCGCCATCTTCCTTTCTCAGCTGGCTCCTCTTCTTC
GCTGACGTTGGTCTCATGGCGTTCCTCGCCCTCAAGGCATATAGGGACGCTGAGAATCTCGATCGGTTCGAGGTT
CCCTTCTTCGGCCCCGTCTCCGGCCGCATCCTAGATGATGAGTAG
Gene >Ophcf2|00097
ATGGACTTTGCTCCTTATCAATCTTCGCCTCCAGAACACGCGCGCGTCGCGTCACCTGAGTCCCTCACGTCACCT
CGCCCATCCCAAGACGCCACCCGCAGAAGCCCCCCCTTGCTGCAGCACCCGCAGCCCCAGCGCGCCTGGGCCGGA
GCTCTAGACGGTCATGCCACCGCTGTTCAAGGCGGTGGAGGCTCGTGGGCCAACGAAGCGCAGCCGGGACCAGAT
CCTGTGAGCGAGTTCGACACGAGCCTCGGCATACGGCTCGATTACGAGGCCTCTCTAGCTTACGTCGCGCTTCCG
CCGCTGGGAGCCATTGTTCTTTTAGTTCTCGAGCGCAATAGCGACTACGTGCGCTTCCACGCCTGGCAGGCCGCC
CTGCTCTTCACCGCCATCCTCGTTCTGCACATCGTCATCTCGCCATCTTCCTTTCTCAGCTGGCTCCTCTTCTTC
GCTGACGTTGGTCTCATGGCGTTCCTCGCCCTCAAGGCATATAGGGACGCTGAGAATCTCGATCGGTGAGCGCGC
TCTGATCTCCTCTTGCATATGATGATCCCAAGCTTACGTGACTATATCAGGTTCGAGGTTCCCTTCTTCGGCCCC
GTCTCCGGCCGCATCCTAGATGATGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail