Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00093
Gene name
Locationscaffold_01:717806..718951
Strand-
Gene length (bp)1145
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01634 HisG ATP phosphoribosyltransferase 7.4E-54 58 241
PF08029 HisG_C HisG, C-terminal domain 6.9E-27 245 317

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0005737 cytoplasm Yes
GO:0000105 histidine biosynthetic process Yes
GO:0003879 ATP phosphoribosyltransferase activity Yes
GO:0043169 cation binding No
GO:0006520 cellular amino acid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0006547 histidine metabolic process No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0016757 glycosyltransferase activity No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0043167 ion binding No
GO:0046394 carboxylic acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0016763 pentosyltransferase activity No
GO:0008652 cellular amino acid biosynthetic process No
GO:0046872 metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0016053 organic acid biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5368 0.3218 0.0106 0.3194 0.5654 0.1632 0.073 0.173 0.0706 0.0073

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1724
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7100
Ophiocordyceps australis map64 (Brazil) OphauB2|5552
Ophiocordyceps camponoti-floridani Ophcf2|00093 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|181
Ophiocordyceps kimflemingae Ophio5|1345
Ophiocordyceps subramaniannii Hirsu2|1564

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00093
MDLVNSLENRLLFAVPKKGRLYQASLNLLEGADIQFRREHRLDIALVKNLPIALIFLPAADIPTFVGQGRVDLGI
TGWDQVQEHEAAIRTDDAGNSGSDSAGCDMVLDLSFGECRLQVQVPENGKYCLGRDLVGGTIGTSFVHLAADYFA
KLESDLAGDDQTDGSAGKLRTKIIELSGSVEAACALGVADGIVDLVESGETMRAAGLKAVDTVLDSMAVLIKSRA
PSNQAMIDLITSRIRGVITAQKYVLCQYNIERDHLAAATKITPGKRAATVTTLDTASWVAVSSMVEKKKVAVVMD
ELCRVGAQDILVLNINNTRY*
Coding >Ophcf2|00093
ATGGACTTAGTCAACAGTCTCGAGAACCGGCTTCTCTTCGCGGTCCCCAAGAAAGGACGACTGTACCAGGCATCT
TTAAACCTGCTGGAAGGCGCCGACATACAATTTCGTCGTGAGCATCGCCTCGACATCGCTCTCGTCAAAAACCTA
CCGATCGCTCTCATCTTCCTTCCTGCCGCCGATATTCCAACCTTTGTCGGCCAGGGTCGCGTTGACCTAGGAATC
ACTGGCTGGGATCAAGTTCAAGAGCACGAAGCCGCCATTCGCACAGATGATGCAGGCAACTCTGGCTCGGATTCT
GCGGGATGCGACATGGTCTTGGACTTGAGCTTCGGCGAATGTCGCCTGCAAGTCCAAGTGCCAGAGAATGGAAAG
TATTGTTTGGGTCGAGATCTTGTGGGTGGCACTATCGGAACTAGCTTTGTCCATCTCGCAGCCGACTATTTCGCG
AAGCTCGAAAGCGATTTAGCTGGTGACGATCAGACCGACGGGTCCGCTGGGAAACTACGCACCAAGATTATTGAG
CTCAGTGGCAGTGTCGAGGCAGCCTGCGCTTTGGGCGTTGCCGATGGCATTGTTGATCTCGTAGAATCCGGAGAG
ACAATGCGCGCCGCCGGCCTCAAGGCAGTCGATACTGTGCTAGACTCTATGGCTGTACTCATTAAGTCCCGCGCA
CCGTCGAATCAAGCTATGATCGACCTCATCACCTCCCGCATTCGTGGCGTCATCACGGCACAGAAGTACGTTTTA
TGCCAGTATAACATCGAACGTGATCATCTGGCCGCAGCCACGAAGATTACGCCCGGCAAACGGGCAGCAACTGTC
ACGACGCTAGACACAGCCAGCTGGGTCGCCGTCAGCTCCATGGTAGAGAAGAAGAAGGTCGCGGTGGTCATGGAC
GAGTTGTGTCGAGTGGGAGCTCAAGACATTCTAGTCCTTAACATTAATAACACTCGCTACTAA
Transcript >Ophcf2|00093
ATGGACTTAGTCAACAGTCTCGAGAACCGGCTTCTCTTCGCGGTCCCCAAGAAAGGACGACTGTACCAGGCATCT
TTAAACCTGCTGGAAGGCGCCGACATACAATTTCGTCGTGAGCATCGCCTCGACATCGCTCTCGTCAAAAACCTA
CCGATCGCTCTCATCTTCCTTCCTGCCGCCGATATTCCAACCTTTGTCGGCCAGGGTCGCGTTGACCTAGGAATC
ACTGGCTGGGATCAAGTTCAAGAGCACGAAGCCGCCATTCGCACAGATGATGCAGGCAACTCTGGCTCGGATTCT
GCGGGATGCGACATGGTCTTGGACTTGAGCTTCGGCGAATGTCGCCTGCAAGTCCAAGTGCCAGAGAATGGAAAG
TATTGTTTGGGTCGAGATCTTGTGGGTGGCACTATCGGAACTAGCTTTGTCCATCTCGCAGCCGACTATTTCGCG
AAGCTCGAAAGCGATTTAGCTGGTGACGATCAGACCGACGGGTCCGCTGGGAAACTACGCACCAAGATTATTGAG
CTCAGTGGCAGTGTCGAGGCAGCCTGCGCTTTGGGCGTTGCCGATGGCATTGTTGATCTCGTAGAATCCGGAGAG
ACAATGCGCGCCGCCGGCCTCAAGGCAGTCGATACTGTGCTAGACTCTATGGCTGTACTCATTAAGTCCCGCGCA
CCGTCGAATCAAGCTATGATCGACCTCATCACCTCCCGCATTCGTGGCGTCATCACGGCACAGAAGTACGTTTTA
TGCCAGTATAACATCGAACGTGATCATCTGGCCGCAGCCACGAAGATTACGCCCGGCAAACGGGCAGCAACTGTC
ACGACGCTAGACACAGCCAGCTGGGTCGCCGTCAGCTCCATGGTAGAGAAGAAGAAGGTCGCGGTGGTCATGGAC
GAGTTGTGTCGAGTGGGAGCTCAAGACATTCTAGTCCTTAACATTAATAACACTCGCTACTAA
Gene >Ophcf2|00093
ATGGACTTAGTCAACAGGTGTGCTTTTGCGCCCCAGATAGGTTACCGTAGCTTGCTGATGTTCTTTAGTCTCGAG
AACCGGCTTCTCTTCGCGGTCCCCAAGAGTAAGCAGCTAACAATTCACCTCAATTCATCAATTGCAATTCGTTTC
TAATGTATTTCTATATATAAAGAAGGACGACTGTACCAGGCATCTTTAAACCTGCTGGAAGGCGCCGACATACAA
TTTCGTCGTGAGCATCGCCTCGACATCGCTCTCGTCAAAAACCTACCGATCGCTCTCATCTTCCTTCCTGCCGCC
GATATTCCAACCTTTGTCGGCCAGGGTCGCGTTGACCTAGGAATCACTGGCTGGGATCAAGTTCAAGAGCACGAA
GCCGCCATTCGCACAGATGATGCAGGCAACTCTGGCTCGGATTCTGCGGGATGCGACATGGTCTTGGACTTGAGC
TTCGGCGAATGTCGCCTGCAAGTCCAAGTGCCAGAGAATGGAAAGTATTGTTTGGGTCGAGATCTTGTGGGTGGC
ACTATCGGAACTAGCTTTGTCCATCTCGCAGCCGACTATTTCGCGAAGCTCGAAAGCGATTTAGCTGGTGACGAT
CAGACCGACGGGTCCGCTGGGAAACTACGCACCAAGATTATTGAGCTCAGTGGCAGTGTCGAGGCAGCCTGCGCT
TTGGGCGTTGCCGATGGCATTGTTGATCTCGTAGGTGGGTGCTTGCTTCCTGCCGTAGGGCGCATTATCGATGGG
CTGACAGCAAGGGTCGAACAGAATCCGGAGAGACAATGCGCGCCGCCGGCCTCAAGGCAGTCGATACTGTGCTAG
ACTCTATGGCTGTACTCATTAAGTCCCGCGCACCGTCGAATCAAGCTATGATCGACCTCATCACCTCCCGCATTC
GTGGCGTCATCACGGCACAGAAGTACGTTTTATGCCAGTATAACATCGAACGTGATCATCTGGCCGCAGCCACGA
AGATTACGCCCGGCAAACGGGCAGCAACTGTCACGACGCTAGACACAGCCAGCTGGGTCGCCGTCAGCTCCATGG
TAGAGAAGAAGAAGGTCGCGGTGGTCATGGACGAGTTGTGTCGAGTGGGAGCTCAAGACATTCTAGTCCTTAACA
TTAATAACACTCGCTACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail