Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00091
Gene name
Locationscaffold_01:690208..692803
Strand+
Gene length (bp)2595
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 4.9E-103 192 455
PF10348 DUF2427 Domain of unknown function (DUF2427) 1.1E-20 1 76

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 2 24 22
2 28 47 19
3 60 82 22
4 187 209 22
5 216 238 22
6 297 319 22
7 354 373 19
8 388 410 22
9 423 440 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00091
MLVCWVLVLPIAVMLSLAGSRFTLLSQYWFLGLNALGLVFGIIYNAQTPDLYPNNAHGKIGWIITMVASAQVLMT
LAGWAGGLWRQGYLPLSSETLFTRHFFSDCSHSDSQQLPNDFHEAPAKTPYQPPYSSAPDHNDYDALLTNNPDDH
IGQDRFDGTAHSSAPLPSSSDKLWRCCAIISKVIDRIILPFGFVAIASGLATFGRLFEGNEIFSGLAHWIKGGVF
FWLGLFTLGRWTGSFGDLGWAWNLPPNTSQRTWQPSAEWVESALIFFYGSTNIFLEHLGSWGGVWSSQDLEHIAV
TVLFIGGGLCGILIESATVRRLLNITVSKTVCRSRPDDGEEAERGHLVAPSYEVSLNPLPTLIILLLGVIMSAHH
QTSGMAVQIHRQWGLLLAGASFARCMTYILIFLRPPRSILPSRPPTELLTAFGLITGGIVFMASSSDTVQSMDYY
NLDSIHSV*
Coding >Ophcf2|00091
ATGCTGGTCTGCTGGGTTCTTGTCTTGCCCATCGCTGTTATGCTGTCTCTGGCCGGCTCCCGGTTCACGTTGTTG
TCGCAATATTGGTTCTTAGGCTTGAACGCGCTAGGTCTCGTCTTTGGAATCATCTACAATGCGCAGACGCCGGAT
CTGTATCCAAATAATGCCCACGGAAAAATAGGCTGGATCATCACTATGGTCGCCTCTGCCCAAGTTCTTATGACT
CTGGCGGGCTGGGCGGGCGGTTTATGGAGGCAAGGGTACCTTCCGCTGTCGAGCGAGACACTCTTCACCAGGCAC
TTTTTCTCGGATTGCTCTCACAGCGACAGCCAGCAACTGCCCAATGACTTTCACGAGGCTCCGGCAAAGACTCCT
TACCAGCCTCCGTATTCTTCGGCTCCAGACCATAACGACTACGATGCCCTTTTGACTAACAATCCCGATGATCAC
ATAGGACAGGATAGGTTTGACGGGACAGCTCATTCGTCGGCCCCCCTACCAAGTTCATCGGATAAGCTGTGGCGG
TGCTGCGCAATAATTTCTAAAGTAATTGACCGCATCATCCTACCCTTTGGCTTTGTCGCGATTGCCAGTGGCCTT
GCCACATTTGGTAGGCTTTTCGAAGGTAATGAAATTTTCAGTGGGCTCGCACACTGGATAAAAGGTGGCGTTTTC
TTTTGGCTGGGCCTATTCACCCTGGGCCGTTGGACTGGAAGCTTTGGCGACCTTGGATGGGCTTGGAACCTGCCT
CCGAATACCAGTCAGCGAACGTGGCAACCGTCAGCTGAGTGGGTTGAGAGCGCTCTCATCTTCTTCTATGGTTCT
ACCAACATCTTCCTTGAGCATCTTGGCTCTTGGGGAGGGGTGTGGAGCTCTCAAGATCTCGAACACATCGCCGTC
ACTGTTCTGTTCATAGGCGGTGGTTTGTGCGGCATACTCATTGAGTCTGCCACAGTTCGAAGGCTACTCAACATC
ACAGTATCGAAAACCGTTTGCAGATCACGACCTGATGACGGTGAAGAGGCAGAAAGGGGCCATCTTGTTGCGCCC
TCCTATGAGGTGTCTCTGAATCCACTACCGACACTCATCATTCTATTGTTAGGGGTTATTATGAGCGCCCACCAC
CAAACATCGGGAATGGCAGTACAGATTCACAGGCAATGGGGCCTCCTGTTAGCAGGTGCTTCGTTCGCTCGTTGC
ATGACCTACATCCTCATTTTCCTACGACCACCTAGGTCGATTCTACCTTCCCGGCCTCCGACGGAGCTTTTGACG
GCATTTGGCCTTATCACTGGTGGCATCGTCTTCATGGCAAGTAGCTCCGACACTGTCCAAAGCATGGACTATTAT
AACTTGGACTCTATACATAGTGTCTAA
Transcript >Ophcf2|00091
ATGCTGGTCTGCTGGGTTCTTGTCTTGCCCATCGCTGTTATGCTGTCTCTGGCCGGCTCCCGGTTCACGTTGTTG
TCGCAATATTGGTTCTTAGGCTTGAACGCGCTAGGTCTCGTCTTTGGAATCATCTACAATGCGCAGACGCCGGAT
CTGTATCCAAATAATGCCCACGGAAAAATAGGCTGGATCATCACTATGGTCGCCTCTGCCCAAGTTCTTATGACT
CTGGCGGGCTGGGCGGGCGGTTTATGGAGGCAAGGGTACCTTCCGCTGTCGAGCGAGACACTCTTCACCAGGCAC
TTTTTCTCGGATTGCTCTCACAGCGACAGCCAGCAACTGCCCAATGACTTTCACGAGGCTCCGGCAAAGACTCCT
TACCAGCCTCCGTATTCTTCGGCTCCAGACCATAACGACTACGATGCCCTTTTGACTAACAATCCCGATGATCAC
ATAGGACAGGATAGGTTTGACGGGACAGCTCATTCGTCGGCCCCCCTACCAAGTTCATCGGATAAGCTGTGGCGG
TGCTGCGCAATAATTTCTAAAGTAATTGACCGCATCATCCTACCCTTTGGCTTTGTCGCGATTGCCAGTGGCCTT
GCCACATTTGGTAGGCTTTTCGAAGGTAATGAAATTTTCAGTGGGCTCGCACACTGGATAAAAGGTGGCGTTTTC
TTTTGGCTGGGCCTATTCACCCTGGGCCGTTGGACTGGAAGCTTTGGCGACCTTGGATGGGCTTGGAACCTGCCT
CCGAATACCAGTCAGCGAACGTGGCAACCGTCAGCTGAGTGGGTTGAGAGCGCTCTCATCTTCTTCTATGGTTCT
ACCAACATCTTCCTTGAGCATCTTGGCTCTTGGGGAGGGGTGTGGAGCTCTCAAGATCTCGAACACATCGCCGTC
ACTGTTCTGTTCATAGGCGGTGGTTTGTGCGGCATACTCATTGAGTCTGCCACAGTTCGAAGGCTACTCAACATC
ACAGTATCGAAAACCGTTTGCAGATCACGACCTGATGACGGTGAAGAGGCAGAAAGGGGCCATCTTGTTGCGCCC
TCCTATGAGGTGTCTCTGAATCCACTACCGACACTCATCATTCTATTGTTAGGGGTTATTATGAGCGCCCACCAC
CAAACATCGGGAATGGCAGTACAGATTCACAGGCAATGGGGCCTCCTGTTAGCAGGTGCTTCGTTCGCTCGTTGC
ATGACCTACATCCTCATTTTCCTACGACCACCTAGGTCGATTCTACCTTCCCGGCCTCCGACGGAGCTTTTGACG
GCATTTGGCCTTATCACTGGTGGCATCGTCTTCATGGCAAGTAGCTCCGACACTGTCCAAAGCATGGACTATTAT
AACTTGGACTCTATACATAGTGTCTAA
Gene >Ophcf2|00091
ATGCTGGTCTGCTGGGTTCTTGTCTTGCCCATCGGTACGCAACGCCTTCTGACTGTCAAACCTGCCAATTGCCGT
TGTTTTCTCACCAAGACCATTAGCTGTTATGCTGTCTCTGGCCGGCTCCCGGTTCACGTTGTTGTCGCAATATTG
GTTCTTAGGCTTGAACGCGCTAGGTCTCGTCTTTGGAATCATCTACAATGCGCAGACGCCGGATCTGTATCCAAA
TAATGCCCACGGAAAAATAGGCTGGATCATCACTATGGTCGCCTCTGCCCAAGTTCTTATGACTCTGGCGGGCTG
GGCGGGCGGTTTATGGAGGCAAGGGTACCTTCCGCTGTCGAGCGAGACACTCTTCACCAGGCACTTTTTCTCGGA
TTGCTCTCACAGCGACAGCCAGCAACTGCCCAATGACTTTCACGAGGCTCCGGCAAAGACTCCTTACCAGCCTCC
GTATTCTTCGGCTCCAGACCATAACGACTACGATGCCCTTTTGACTAACAATCCCGATGATCACATAGGACAGGA
TAGGTTTGACGGGACAGCTCATTCGTCGGCCCCCCTACCAAGTTCATCGGATAAGCTGTGGCGGTGCTGCGCAAT
AATTTCTAAAGTAATTGACCGCATCATCCTACCCTTTGGCTTTGTCGCGATTGCCAGTGGCCTTGCCACATTTGG
TAGGCTTTTCGTACGTTGGTGTCTCGTCAATCTCAAGCCGGCGGCTCCAAGTTTTCTAGCTAATGCCATGCGATA
GGAAGGTAATGAAATTTTCAGTGGGCTCGCACACTGGATAAAAGGTGGCGTTTTCTTTTGGCTGGGCCTATTCAC
CCTGGGCCGTTGGACTGGAAGCTTTGGCGACCTTGGATGGGCTTGGAACCTGCCTCCGAATACCAGTCAGCGAAC
GTGGCAACCGTCAGCTGAGTGGGTTGAGAGCGCTCTCATCTTCTTCTATGGTTCTACCAACATCTTCCTTGAGCA
TCTTGGCTCTTGGGGAGGGGTGTGGAGCTCTCAAGATCTCGAACACATCGCCGTCACTGTTCTGTTCATAGGCGG
TGGTTTGGTAGGCGTCTTCTTATCTTAAAAACCAAACCACTAACATTGATGCTTCTCAGTGCGGCATACTCATTG
AGTCTGCCACAGTTCGAAGGCTACTCAACATCACAGTATCGAAAACCGTTTGCAGATCACGACCTGATGACGGTG
AAGAGGCAGAAAGGGGCCATCTTGTTGCGCCCTCCTATGAGGTGTCTCTGAATCCACTACCGACACTCATCATTC
TATTGTTAGGGGTTATTATGAGCGCCCACCACCAAACATCGGGAATGGCAGTACAGATTCACAGGCAATGGGGCC
TCCTGTTAGCAGGTGCTTCGTTCGCTCGTTGCATGACCTACATCCTCATTTTCCTACGACCACCTAGGTCGATTC
TACCTTCCCGGCCTCCGACGGAGCTTTTGACGGCATTTGGCCTTATCACTGGTGGCATCGTCTTCATGGCAAGTG
TATGTTTACTCGAGCCAATGCTTGTTTCAACGTTATGCAAGGTTAGGCTGACGATGTGAAAAGAGCTCCGACACT
GTCCAAAGCATGGACTATTATAACTTGGACTCTATGTTTGTGTTCACATTAACCTCTGGATTTGTAGGTGTCTTG
ATGGCGTGGGTAATAATTATCCTGTCAATTAAAGGTTGGGCTATAAGTGAAGAAGAACAGCACATGTTAACACTG
CATAGGTAAGTGTTTGACTGTTAACAAAGATAATACATATGTTACACAGGTAGTCAAGTATGTATAAGAATTTAT
ATAGTATATGTTATGGTGTGAGTGGGCCTATATAATGACAAAAAGGGGTATCTGTTATTAGGGGCGTAAGGGCAT
CGTTAATGCACTCGTTAAAGGTCTGTAATAAGTGTATATCTCTCCTTTAGATGTTCTAAAGCAAGTCTAAGCTAT
TTAATAAAGTATAATATACTTACTTATGTTATTTAAGGCTATAGTACTACCTATATAGGCTAATCTATATATAGG
TATTTATTATTCTATATTATCTATATTTAGAACATATACTCTTCTGTTAAGGAGAAGGGTAAGTAGATTAATTAT
ATATAAGGTCTATTATAATAGTTATAAGCCTAGTTGTATTATTACTTATAAATTACTTTTCCTCTAATCTTATTT
AATACCTTTAATTAATTAAATTCTTTATTTATTTAATTAATTTACCTAATTAAACGAAACTAATCTTTATAAGCT
AAAAAGTAAAGCTATTACTATTTTAACTTATACTACTTATACTAACTTTACTTAACTATAACTTTGTTCTCTCTA
TATTAATTATTATTAAATTTTCCTATAAAATACTACTAAAATATCTTCTTCTAGTAATAACAATAATAAGATCCT
CTACTATCTTAATAAGCCCTTAGATTACTCTCGCGAGTATTATAAAGTAAAGGCTTTAGCTAAGTCTTAATAAAC
CTAGGACCTAGTTAACCCTAATAGCTTATTAGAGCTTATAGTCCCTATTATACTAGAATTCCCTATTATACTAAA
AGAACCTAGGATTACTTACTCTTCTACTTAAGACATAGTGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail