Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00090
Gene name
Locationscaffold_01:674309..679331
Strand-
Gene length (bp)5022
Transcript length (bp)4596
Coding sequence length (bp)4596
Protein length (aa) 1532

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00520 Ion_trans Ion transport protein 2.5E-27 2 208
PF00520 Ion_trans Ion transport protein 6.0E-23 243 471
PF00520 Ion_trans Ion transport protein 1.6E-31 675 954
PF00520 Ion_trans Ion transport protein 4.4E-23 1005 1253

GO

GO Term Description Terminal node
GO:0005216 ion channel activity Yes
GO:0016020 membrane Yes
GO:0006811 ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0015267 channel activity No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022803 passive transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 7 24 17
2 28 50 22
3 175 197 22
4 242 259 17
5 300 322 22
6 326 348 22
7 355 377 22
8 435 457 22
9 670 692 22
10 707 729 22
11 742 764 22
12 810 832 22
13 926 948 22
14 1005 1024 19
15 1037 1059 22
16 1069 1088 19
17 1095 1112 17
18 1127 1149 22
19 1221 1243 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00090
MLSCLRILRLLALTHGTAIILRSLKKAAPLLVRVAFLICFFWLLFAIIGVQSFKSSLSRQCVWLDPLDPKNLTAS
FTVELEFCGGHRDNETGQIMPWVKFSSTESLDELVNGTGNGKGFICPRGSICLQQKGPFNGTVSFDDIFHSLELV
FVIMSANTFSDLMYYTMGSDYLQAALFFGACIMMLMLWLTSLLIAVITSSFQVIREESKSSAFTVDPEPFANPGP
DERLRRPSTLQRLYDNTSIFWVIVIAFGLVCQSCRSSTMSRARVTFINLSEAIVTIVLDLEIIIRFSANWRRFHL
SWRNIFDFGLAAITTIILIPSIRNSPAYQWLTVFQILRVYRIVLAIPVTRKLISLVLGNAAGIANLMLFVFLMTF
LVAIFASQLFRGVVAASKGNEPNRITFATMYNSFLGMYQVLSSENWTEILYSVTAYTTDFRVAWIGAIFLIGWFV
LSFFILINMFIAVIQENFDVSEDEKRLEQVRAFLQRKELGQTSSNIALSTIFSLGKSRRRRDPLDYGPAMMEMLL
KDAVVRDFLNDEVTDSLQDQARPGGLAPRSATTLFGADVKPGFLSKLWAKLSQRSGEQGPNPFYSNIRFDGPNDT
MDPRQMARQAVSATSARRKAQREYLACHPRYNDSLFVFRPKNPLRLICQRIVGPARGFERFDGVQPKKIAWYIFS
MLVYAVVVAMVVLACVTTPLYQKEYREKHPSVVLGWYVWTDLAFAVFFTFEAAVKVVADGLLWTPNAYLRSSWGT
IDSIVLLTLWINVVTLLANDGAISRAVGAFKALRALRLLNVSDSARDTFHSLIIVGWWKLFGAAFISLSLLIPFA
VYGLNLFNGKMIACNDSDGLFVLDSCFGEYGSTPFKDDWLMLAPRVASNPYFNFDDFGSSLFTLFQIVSQEGWTD
VSFAAQNIVGRGKQPQNLATQGNAMFFVVFNLMATVFVLTLFISVFMRNYTEQTGVAFLTAEQRSWLELRKLLRH
ISPSKSSYNGMEKEWKKWCHKKAIEKRGKWYQVITVVLALHLLLLVAEFRTEPLWWSRTRVLAFLILILIYLANI
SIRIVGLGWARFRRSSWDLYSLVTVSGAFLATLALLIADTRAETYVQLHKFFLVAIVLLLIPRNDALDQLFKTAA
ASLTVIGNLLATWLVLFLVFAIAMTQTFSLTRFGGEETGNVNFRTVPKALILLFRMSLGEGWNKVMEDYAEIEPP
LCVEQHRFFNSDCGSKAWARFLFVSWNIVSMYIFVNLFVSLIYESFSYVYQRSSGVAVVDREEIRRFKEAWRSVD
PAGTGFITKEAFPRLLGELSGVFQMRIYEPQDSVRQILEDVRGEDVLMILAHYNIINDSKSLRLAEFLRRRARLQ
RVDEEIRRKIVQGFFDTLYWSRKFKKHMERKRTARMSGVPGMPVPDIFADDDHRDDMSKPFGSEQASATRWTHLS
VGEGAMRNTTTSEAEVHQGGTGYQHPLSHSRSSTCTATATGQGAASGFSFEIYEPESRHQGQDGWDESRIESAMS
PSQARHIVDDSVWVDSIRRSSTLRRSARGSR*
Coding >Ophcf2|00090
ATGTTGAGTTGCCTGCGAATCCTTCGTTTGCTGGCTCTCACCCACGGAACTGCAATAATCTTGCGAAGTTTGAAG
AAGGCCGCGCCGCTTCTCGTTCGTGTTGCTTTCCTTATCTGCTTCTTCTGGTTGCTTTTCGCCATTATCGGCGTT
CAGAGCTTCAAGTCGAGTCTCAGCCGTCAATGCGTCTGGCTTGATCCTCTGGATCCGAAAAACCTTACGGCATCT
TTCACAGTGGAATTGGAGTTCTGTGGCGGTCACCGGGATAACGAAACCGGGCAGATTATGCCTTGGGTCAAGTTT
AGCTCCACCGAGTCTCTGGATGAATTAGTCAATGGAACGGGTAATGGCAAGGGATTCATCTGTCCCCGTGGCTCC
ATTTGTCTGCAACAAAAAGGCCCTTTCAATGGCACCGTCAGTTTCGATGACATCTTTCACTCGTTGGAGCTCGTC
TTCGTCATCATGAGCGCCAACACGTTTTCCGACTTGATGTATTATACGATGGGTTCCGACTATCTACAGGCCGCT
CTTTTCTTCGGCGCCTGCATCATGATGTTGATGCTGTGGCTGACAAGTCTTTTGATCGCTGTCATAACGTCGTCT
TTCCAGGTCATTCGCGAAGAGAGCAAGTCGAGCGCTTTTACGGTCGATCCTGAACCGTTCGCTAACCCCGGTCCG
GACGAACGTCTGCGACGACCTTCGACTCTGCAACGACTATACGACAATACATCAATATTCTGGGTCATTGTCATC
GCATTTGGACTTGTTTGTCAATCATGTCGAAGTTCTACCATGTCCAGGGCACGTGTGACGTTCATTAACCTCAGC
GAAGCCATTGTGACCATTGTCCTCGACCTGGAGATTATTATCCGCTTCTCTGCAAATTGGCGAAGATTTCACTTA
AGCTGGCGAAACATCTTCGATTTCGGTTTGGCGGCAATCACCACCATTATATTGATACCATCCATCCGCAACTCC
CCCGCCTATCAGTGGCTCACCGTCTTCCAGATCTTACGAGTCTACAGGATTGTGTTGGCAATTCCCGTCACCCGG
AAATTGATATCATTGGTGTTGGGCAACGCGGCCGGTATCGCGAACCTGATGCTCTTCGTCTTCCTAATGACCTTC
TTGGTCGCCATCTTCGCTTCTCAATTATTCAGGGGAGTTGTGGCTGCCTCGAAAGGTAACGAACCAAATCGCATC
ACCTTCGCCACGATGTACAACTCCTTTCTCGGCATGTATCAAGTCCTGTCGAGCGAGAATTGGACCGAGATCCTC
TATTCAGTCACTGCATACACGACAGATTTCAGGGTGGCTTGGATAGGGGCCATCTTTCTTATTGGGTGGTTTGTG
CTTTCATTCTTCATTCTGATCAATATGTTCATTGCTGTCATCCAAGAGAACTTTGACGTTTCCGAGGACGAGAAG
CGCTTGGAACAAGTCAGGGCATTTCTGCAGAGAAAAGAATTGGGCCAGACATCCAGCAATATTGCGCTTTCCACG
ATATTCAGTTTAGGAAAATCACGTCGCCGCCGAGACCCCCTAGATTACGGCCCAGCTATGATGGAGATGCTTCTG
AAGGACGCTGTTGTGCGGGACTTTCTCAACGATGAGGTGACGGATTCGCTCCAAGACCAAGCAAGGCCGGGCGGC
CTGGCGCCGAGAAGCGCGACCACCCTTTTCGGAGCCGACGTGAAGCCCGGCTTTCTATCCAAATTATGGGCAAAG
TTATCCCAGCGCTCGGGTGAGCAGGGGCCGAACCCATTCTATTCCAATATACGATTTGATGGTCCCAATGACACT
ATGGACCCTCGGCAAATGGCCCGACAAGCTGTTTCAGCAACCTCTGCTCGGCGCAAGGCTCAGCGAGAGTACCTT
GCCTGTCACCCTCGTTACAACGACTCTCTCTTCGTGTTTCGACCAAAGAATCCCCTGCGACTGATTTGTCAACGA
ATTGTTGGTCCGGCTAGAGGCTTTGAGAGATTCGATGGCGTCCAGCCCAAGAAAATTGCCTGGTACATCTTCTCC
ATGCTGGTGTATGCGGTCGTTGTGGCAATGGTCGTACTGGCCTGTGTCACCACGCCGTTATACCAGAAGGAATAC
AGGGAGAAACATCCAAGTGTCGTCTTGGGATGGTACGTCTGGACCGACTTGGCTTTCGCCGTCTTCTTCACCTTT
GAAGCAGCGGTAAAGGTTGTTGCAGATGGGCTTCTCTGGACACCCAACGCTTACCTGCGGAGCTCATGGGGCACC
ATTGACAGCATTGTCCTATTAACACTTTGGATCAATGTTGTCACACTTCTGGCCAACGATGGCGCCATTTCGCGG
GCTGTTGGCGCTTTCAAAGCCCTTCGGGCCCTGCGTCTACTCAATGTCAGCGACAGTGCAAGAGACACGTTTCAT
TCATTGATCATTGTTGGCTGGTGGAAGCTGTTTGGAGCAGCATTTATATCACTATCTCTCCTAATACCTTTTGCA
GTCTATGGACTGAACCTGTTCAACGGGAAAATGATCGCCTGCAATGATTCCGATGGCCTGTTCGTCCTGGATAGT
TGTTTTGGCGAGTACGGCAGCACTCCCTTCAAAGACGACTGGCTTATGCTTGCTCCTCGAGTTGCGTCGAACCCT
TATTTCAACTTTGATGACTTTGGATCTTCGCTCTTCACGCTGTTTCAGATTGTGAGCCAAGAGGGATGGACAGAT
GTATCATTCGCCGCGCAGAATATTGTCGGCCGGGGCAAGCAGCCTCAAAACCTTGCGACTCAGGGGAATGCCATG
TTTTTTGTCGTCTTCAACTTGATGGCGACTGTCTTCGTCCTCACCCTTTTTATCTCGGTCTTCATGAGGAACTAT
ACGGAGCAGACCGGAGTCGCCTTTCTTACCGCCGAACAGAGATCTTGGCTCGAGCTGCGCAAGCTTCTGCGCCAC
ATCTCGCCGTCCAAAAGCTCTTACAACGGCATGGAGAAAGAATGGAAGAAATGGTGCCACAAAAAAGCCATTGAG
AAACGGGGCAAGTGGTATCAAGTCATTACCGTCGTTCTCGCACTTCACCTCCTCCTTCTGGTGGCGGAATTCCGA
ACAGAACCGCTGTGGTGGTCCCGCACTCGGGTGCTCGCTTTCCTCATCTTAATCTTGATATATCTGGCAAACATC
AGCATCCGGATAGTTGGCCTTGGCTGGGCCAGGTTTCGACGGAGCTCGTGGGATTTATACTCGCTTGTCACGGTG
TCCGGGGCATTCTTGGCAACTCTGGCCCTCCTGATAGCTGACACCAGGGCAGAGACCTATGTTCAGCTCCACAAA
TTCTTTCTTGTTGCCATTGTTCTCCTGCTGATACCGCGCAACGACGCGCTGGATCAACTTTTTAAGACGGCAGCG
GCGAGCTTGACCGTCATCGGAAACCTGCTGGCCACTTGGCTTGTTCTCTTTCTTGTATTCGCCATCGCCATGACA
CAGACCTTTAGCTTAACCCGCTTCGGGGGCGAGGAAACGGGAAATGTCAACTTCCGCACGGTCCCCAAGGCCTTG
ATACTCTTGTTCCGAATGAGCCTCGGCGAGGGCTGGAACAAAGTCATGGAAGATTACGCCGAAATTGAACCACCG
CTGTGCGTCGAGCAACACAGATTCTTCAACAGTGACTGCGGCAGCAAGGCTTGGGCCAGGTTCCTGTTCGTATCA
TGGAATATTGTGAGCATGTACATATTTGTCAACCTGTTCGTCTCCCTCATCTACGAGAGTTTCAGTTACGTCTAC
CAACGATCCAGCGGCGTGGCAGTGGTCGATCGAGAGGAGATACGCCGTTTCAAGGAAGCCTGGCGCAGCGTGGAT
CCCGCAGGGACGGGTTTCATCACCAAGGAAGCATTTCCGCGTCTTCTCGGCGAACTTTCGGGCGTCTTCCAGATG
CGAATATATGAGCCACAGGACTCGGTGAGACAGATATTGGAAGACGTGCGCGGCGAAGACGTTTTAATGATTCTG
GCGCATTACAACATTATCAATGACAGCAAAAGCCTCAGGCTTGCCGAGTTTCTTCGCCGCAGAGCGCGGCTGCAG
CGCGTAGACGAGGAGATACGGCGCAAGATCGTCCAGGGCTTCTTCGACACGCTATATTGGAGTAGAAAGTTCAAG
AAGCACATGGAACGCAAACGGACGGCACGAATGTCAGGGGTGCCGGGAATGCCGGTTCCAGACATTTTTGCCGAC
GATGATCACAGAGATGACATGTCGAAGCCGTTTGGTTCCGAGCAAGCGTCTGCCACACGATGGACGCACTTGAGC
GTTGGTGAAGGGGCCATGCGTAATACGACGACGAGCGAGGCGGAAGTACACCAAGGCGGGACAGGATACCAACAC
CCTCTGAGCCATTCTCGATCATCGACGTGCACGGCGACGGCGACGGGCCAGGGTGCCGCTTCAGGATTCAGCTTC
GAGATATACGAGCCTGAAAGTCGACATCAGGGGCAAGATGGATGGGATGAGAGTCGTATAGAGAGCGCAATGAGC
CCGTCGCAAGCCCGGCACATTGTGGACGATTCGGTTTGGGTTGACAGCATCAGACGCAGTTCCACGCTTCGCAGG
TCCGCCAGGGGCTCGAGGTAA
Transcript >Ophcf2|00090
ATGTTGAGTTGCCTGCGAATCCTTCGTTTGCTGGCTCTCACCCACGGAACTGCAATAATCTTGCGAAGTTTGAAG
AAGGCCGCGCCGCTTCTCGTTCGTGTTGCTTTCCTTATCTGCTTCTTCTGGTTGCTTTTCGCCATTATCGGCGTT
CAGAGCTTCAAGTCGAGTCTCAGCCGTCAATGCGTCTGGCTTGATCCTCTGGATCCGAAAAACCTTACGGCATCT
TTCACAGTGGAATTGGAGTTCTGTGGCGGTCACCGGGATAACGAAACCGGGCAGATTATGCCTTGGGTCAAGTTT
AGCTCCACCGAGTCTCTGGATGAATTAGTCAATGGAACGGGTAATGGCAAGGGATTCATCTGTCCCCGTGGCTCC
ATTTGTCTGCAACAAAAAGGCCCTTTCAATGGCACCGTCAGTTTCGATGACATCTTTCACTCGTTGGAGCTCGTC
TTCGTCATCATGAGCGCCAACACGTTTTCCGACTTGATGTATTATACGATGGGTTCCGACTATCTACAGGCCGCT
CTTTTCTTCGGCGCCTGCATCATGATGTTGATGCTGTGGCTGACAAGTCTTTTGATCGCTGTCATAACGTCGTCT
TTCCAGGTCATTCGCGAAGAGAGCAAGTCGAGCGCTTTTACGGTCGATCCTGAACCGTTCGCTAACCCCGGTCCG
GACGAACGTCTGCGACGACCTTCGACTCTGCAACGACTATACGACAATACATCAATATTCTGGGTCATTGTCATC
GCATTTGGACTTGTTTGTCAATCATGTCGAAGTTCTACCATGTCCAGGGCACGTGTGACGTTCATTAACCTCAGC
GAAGCCATTGTGACCATTGTCCTCGACCTGGAGATTATTATCCGCTTCTCTGCAAATTGGCGAAGATTTCACTTA
AGCTGGCGAAACATCTTCGATTTCGGTTTGGCGGCAATCACCACCATTATATTGATACCATCCATCCGCAACTCC
CCCGCCTATCAGTGGCTCACCGTCTTCCAGATCTTACGAGTCTACAGGATTGTGTTGGCAATTCCCGTCACCCGG
AAATTGATATCATTGGTGTTGGGCAACGCGGCCGGTATCGCGAACCTGATGCTCTTCGTCTTCCTAATGACCTTC
TTGGTCGCCATCTTCGCTTCTCAATTATTCAGGGGAGTTGTGGCTGCCTCGAAAGGTAACGAACCAAATCGCATC
ACCTTCGCCACGATGTACAACTCCTTTCTCGGCATGTATCAAGTCCTGTCGAGCGAGAATTGGACCGAGATCCTC
TATTCAGTCACTGCATACACGACAGATTTCAGGGTGGCTTGGATAGGGGCCATCTTTCTTATTGGGTGGTTTGTG
CTTTCATTCTTCATTCTGATCAATATGTTCATTGCTGTCATCCAAGAGAACTTTGACGTTTCCGAGGACGAGAAG
CGCTTGGAACAAGTCAGGGCATTTCTGCAGAGAAAAGAATTGGGCCAGACATCCAGCAATATTGCGCTTTCCACG
ATATTCAGTTTAGGAAAATCACGTCGCCGCCGAGACCCCCTAGATTACGGCCCAGCTATGATGGAGATGCTTCTG
AAGGACGCTGTTGTGCGGGACTTTCTCAACGATGAGGTGACGGATTCGCTCCAAGACCAAGCAAGGCCGGGCGGC
CTGGCGCCGAGAAGCGCGACCACCCTTTTCGGAGCCGACGTGAAGCCCGGCTTTCTATCCAAATTATGGGCAAAG
TTATCCCAGCGCTCGGGTGAGCAGGGGCCGAACCCATTCTATTCCAATATACGATTTGATGGTCCCAATGACACT
ATGGACCCTCGGCAAATGGCCCGACAAGCTGTTTCAGCAACCTCTGCTCGGCGCAAGGCTCAGCGAGAGTACCTT
GCCTGTCACCCTCGTTACAACGACTCTCTCTTCGTGTTTCGACCAAAGAATCCCCTGCGACTGATTTGTCAACGA
ATTGTTGGTCCGGCTAGAGGCTTTGAGAGATTCGATGGCGTCCAGCCCAAGAAAATTGCCTGGTACATCTTCTCC
ATGCTGGTGTATGCGGTCGTTGTGGCAATGGTCGTACTGGCCTGTGTCACCACGCCGTTATACCAGAAGGAATAC
AGGGAGAAACATCCAAGTGTCGTCTTGGGATGGTACGTCTGGACCGACTTGGCTTTCGCCGTCTTCTTCACCTTT
GAAGCAGCGGTAAAGGTTGTTGCAGATGGGCTTCTCTGGACACCCAACGCTTACCTGCGGAGCTCATGGGGCACC
ATTGACAGCATTGTCCTATTAACACTTTGGATCAATGTTGTCACACTTCTGGCCAACGATGGCGCCATTTCGCGG
GCTGTTGGCGCTTTCAAAGCCCTTCGGGCCCTGCGTCTACTCAATGTCAGCGACAGTGCAAGAGACACGTTTCAT
TCATTGATCATTGTTGGCTGGTGGAAGCTGTTTGGAGCAGCATTTATATCACTATCTCTCCTAATACCTTTTGCA
GTCTATGGACTGAACCTGTTCAACGGGAAAATGATCGCCTGCAATGATTCCGATGGCCTGTTCGTCCTGGATAGT
TGTTTTGGCGAGTACGGCAGCACTCCCTTCAAAGACGACTGGCTTATGCTTGCTCCTCGAGTTGCGTCGAACCCT
TATTTCAACTTTGATGACTTTGGATCTTCGCTCTTCACGCTGTTTCAGATTGTGAGCCAAGAGGGATGGACAGAT
GTATCATTCGCCGCGCAGAATATTGTCGGCCGGGGCAAGCAGCCTCAAAACCTTGCGACTCAGGGGAATGCCATG
TTTTTTGTCGTCTTCAACTTGATGGCGACTGTCTTCGTCCTCACCCTTTTTATCTCGGTCTTCATGAGGAACTAT
ACGGAGCAGACCGGAGTCGCCTTTCTTACCGCCGAACAGAGATCTTGGCTCGAGCTGCGCAAGCTTCTGCGCCAC
ATCTCGCCGTCCAAAAGCTCTTACAACGGCATGGAGAAAGAATGGAAGAAATGGTGCCACAAAAAAGCCATTGAG
AAACGGGGCAAGTGGTATCAAGTCATTACCGTCGTTCTCGCACTTCACCTCCTCCTTCTGGTGGCGGAATTCCGA
ACAGAACCGCTGTGGTGGTCCCGCACTCGGGTGCTCGCTTTCCTCATCTTAATCTTGATATATCTGGCAAACATC
AGCATCCGGATAGTTGGCCTTGGCTGGGCCAGGTTTCGACGGAGCTCGTGGGATTTATACTCGCTTGTCACGGTG
TCCGGGGCATTCTTGGCAACTCTGGCCCTCCTGATAGCTGACACCAGGGCAGAGACCTATGTTCAGCTCCACAAA
TTCTTTCTTGTTGCCATTGTTCTCCTGCTGATACCGCGCAACGACGCGCTGGATCAACTTTTTAAGACGGCAGCG
GCGAGCTTGACCGTCATCGGAAACCTGCTGGCCACTTGGCTTGTTCTCTTTCTTGTATTCGCCATCGCCATGACA
CAGACCTTTAGCTTAACCCGCTTCGGGGGCGAGGAAACGGGAAATGTCAACTTCCGCACGGTCCCCAAGGCCTTG
ATACTCTTGTTCCGAATGAGCCTCGGCGAGGGCTGGAACAAAGTCATGGAAGATTACGCCGAAATTGAACCACCG
CTGTGCGTCGAGCAACACAGATTCTTCAACAGTGACTGCGGCAGCAAGGCTTGGGCCAGGTTCCTGTTCGTATCA
TGGAATATTGTGAGCATGTACATATTTGTCAACCTGTTCGTCTCCCTCATCTACGAGAGTTTCAGTTACGTCTAC
CAACGATCCAGCGGCGTGGCAGTGGTCGATCGAGAGGAGATACGCCGTTTCAAGGAAGCCTGGCGCAGCGTGGAT
CCCGCAGGGACGGGTTTCATCACCAAGGAAGCATTTCCGCGTCTTCTCGGCGAACTTTCGGGCGTCTTCCAGATG
CGAATATATGAGCCACAGGACTCGGTGAGACAGATATTGGAAGACGTGCGCGGCGAAGACGTTTTAATGATTCTG
GCGCATTACAACATTATCAATGACAGCAAAAGCCTCAGGCTTGCCGAGTTTCTTCGCCGCAGAGCGCGGCTGCAG
CGCGTAGACGAGGAGATACGGCGCAAGATCGTCCAGGGCTTCTTCGACACGCTATATTGGAGTAGAAAGTTCAAG
AAGCACATGGAACGCAAACGGACGGCACGAATGTCAGGGGTGCCGGGAATGCCGGTTCCAGACATTTTTGCCGAC
GATGATCACAGAGATGACATGTCGAAGCCGTTTGGTTCCGAGCAAGCGTCTGCCACACGATGGACGCACTTGAGC
GTTGGTGAAGGGGCCATGCGTAATACGACGACGAGCGAGGCGGAAGTACACCAAGGCGGGACAGGATACCAACAC
CCTCTGAGCCATTCTCGATCATCGACGTGCACGGCGACGGCGACGGGCCAGGGTGCCGCTTCAGGATTCAGCTTC
GAGATATACGAGCCTGAAAGTCGACATCAGGGGCAAGATGGATGGGATGAGAGTCGTATAGAGAGCGCAATGAGC
CCGTCGCAAGCCCGGCACATTGTGGACGATTCGGTTTGGGTTGACAGCATCAGACGCAGTTCCACGCTTCGCAGG
TCCGCCAGGGGCTCGAGGTAA
Gene >Ophcf2|00090
ATGTTGAGTTGCCTGCGAATCCTTCGTTTGCTGGCTCTCACCCACGGAACTGCAGTAAGTGAAGAAGAATGGACA
GCCGCTATAGCCCACTGCTGACAATGGGTAGATAATCTTGCGAAGTTTGAAGAAGGCCGCGCCGCTTCTCGTTCG
TGTTGCTTTCCTTATCTGCTTCTTCTGGTTGCTTTTCGCCATTATCGGCGTTCAGAGCTTCAAGTCGAGTCTCAG
CCGTCAATGCGTCTGGCTTGATCCTCTGGATCCGAAAAACCTTACGGCATCTTTCACAGTGGAATTGGAGTTCTG
TGGCGGTCACCGGGATAACGAAACCGGGCAGATTATGCCTTGGGTCAAGTTTAGCTCCACCGAGTCTCTGGATGA
ATTAGTCAATGGAACGGGTAATGGCAAGGGATTCATCTGTCCCCGTGGCTCCATTTGTCTGCAACAAAAAGGCCC
TTTCAATGGCACCGTCAGTTTCGATGACATCTTTCACTCGTTGGAGCTCGTCTTCGTCATCATGAGCGCCAACAC
GTTTTCCGACTTGATGTATTATACGATGGGTTCCGACTATCTACAGGCCGCTCTTTTCTTCGGCGCCTGCATCAT
GATGTTGATGCTGTGGCTGACAAGTCTTTTGATCGCTGTCATAACGTCGTCTTTCCAGGTCATTCGCGAAGAGAG
CAAGTCGAGCGCTTTTACGGTCGATCCTGAACCGTTCGCTAACCCCGGTCCGGACGAACGTCTGCGACGACCTTC
GACTCTGCAACGACTATACGACAATACATCAATATTCTGGGTCATTGTCATCGCATTTGGACTTGTTTGTCAATC
ATGTCGAAGTTCTACCATGTCCAGGGCACGTGTGACGTTCATTAACCTCAGCGAAGCCATTGTGACCATTGTCCT
CGACCTGGAGATTATTATCCGCTTCTCTGCAAATTGGCGAAGATTTCACTTAAGCTGGCGAAACATCTTCGATTT
CGGTTTGGCGGCAATCACCACCATTATATTGATACCATCCATCCGCAACTCCCCCGCCTATCAGTGGCTCACCGT
CTTCCAGATCTTACGAGTCTACAGGATTGTGTTGGCAATTCCCGTCACCCGGAAATTGATATCATTGGTGTTGGG
CAACGCGGCCGGTATCGCGAACCTGATGCTCTTCGTCTTCCTAATGACCTTCTTGGTCGCCATCTTCGCTTCTCA
ATTATTCAGGGGAGTTGTGGCTGCCTCGAAAGGTAACGAACCAAATCGCATCACCTTCGCCACGATGTACAACTC
CTTTCTCGGCATGTATCAAGTCCTGTCGAGCGAGAATTGGACCGAGATCCTCTATTCAGTCACTGCATACACGAC
AGATTTCAGGGTGGCTTGGATAGGGGCCATCTTTCTTATTGGGTGGTTTGTGCTTTCATTCTTCATTCTGATCAA
TATGTTCATTGCTGTCATCCAAGAGAACTTTGACGTTTCCGAGGACGAGAAGCGCTTGGAACAAGTCAGGGCATT
TCTGCAGAGAAAAGAATTGGGCCAGACATCCAGCAATATTGCGCTTTCCACGATATTCAGTTTAGGAAAATCACG
TCGCCGCCGAGACCCCCTAGATTACGGCCCAGCTATGATGGAGATGCTTCTGAAGGACGCTGTTGTGCGGGACTT
TCTCAACGATGAGGTGACGGATTCGCTCCAAGACCAAGCAAGGCCGGGCGGCCTGGCGCCGAGAAGCGCGACCAC
CCTTTTCGGAGCCGACGTGAAGCCCGGCTTTCTATCCAAATTATGGGCAAAGTTATCCCAGCGCTCGGGTGAGCA
GGGGCCGAACCCATTCTATTCCAATATACGATTTGATGGTCCCAATGACACTATGGACCCTCGGCAAATGGCCCG
ACAAGCTGTTTCAGCAACCTCTGCTCGGCGCAAGGCTCAGCGAGAGTACCTTGCCTGTCACCCTCGTTACAACGA
CTCTCTCTTCGTGTTTCGACCAAAGAATCCCCTGCGACTGATTTGTCAACGAATTGTTGGTCCGGCTAGAGGCTT
TGAGAGATTCGATGGCGTCCAGCCCAAGAAAATTGCCTGGTACATCTTCTCCATGCTGGTGTATGCGGTCGTTGT
GGCAATGGTCGTACTGGCCTGTGTCACCACGCCGTTATACCAGAAGGAATACAGGGAGAAACATCCAAGTGTCGT
CTTGGGATGGTACGTCTGGACCGACTTGGCTTTCGCCGTCTTCTTCACCTTTGAAGCAGCGGTAAAGGTTGTTGC
AGATGGGCTTCTCTGGACACCCAACGCTTACCTGCGGAGCTCATGGGGCACCATTGACAGCATTGTCCTATTAAC
ACTTTGGATCAATGTTGTCACACTTCTGGCCAACGATGGCGCCATTTCGCGGGCTGTTGGCGCTTTCAAAGCCCT
TCGGGCCCTGCGTCTACTCAATGTCAGCGACAGTGCAAGAGACACGTTTCATTCATTGATCATTGTTGGCTGGTG
GAAGCTGTTTGGAGTAAGTGCCCTCCTATTCGTCTTGCTCGTCAACGCACATTCTAATGTCATCGCTCGGTACAG
GCAGCATTTATATCACTATCTCTCCTAATACCTTTTGCAGTCTATGGACTGAACCTGTTCAACGGGAAAATGATC
GCCTGCAATGATTCCGATGGCCTGTTCGTCCTGGATAGTTGTTTTGGCGAGTACGGCAGCACTCCCTTCAAAGAC
GACTGGCTTATGCTTGCTCCTCGAGTTGCGTCGAACCCTTATTTCAACTTTGATGACTTTGGATCTTCGCTCTTC
ACGCTGTTTCAGATTGTGAGCCAAGAGGGATGGACAGATGTATCATTCGCCGCGCAGAATATTGTCGGCCGGGGC
AAGCAGCCTCAAAACCTTGCGACTCAGGGGAATGCCATGTTTTTTGTCGTCTTCAACTTGATGGCGACTGTCTTC
GTCCTCACCCTTTTTATCTCGGTCTTCATGAGGAACTATACGGAGCAGACCGGAGTCGCCTTTCTTACCGCCGAA
CAGAGATCTTGGCTCGAGCTGCGCAAGCTTCTGCGCCACATCTCGCCGTCCAAAAGCTCTTACAACGGCATGGAG
AAAGAATGGAAGAAATGGTGCCACAAAAAAGCCATTGAGAAACGGGGCAAGTGGTATCAAGTCATTACCGTCGTT
CTCGCACTTCACCTCCTCCTTCTGGTGGCGGAATTCCGAACAGAACCGCTGTGGTGGTCCCGCACTCGGGTGCTC
GCTTTCCTCATCTTAATCTTGATATATCTGGCAAACATCAGCATCCGGATAGTTGGCCTTGGCTGGGCCAGGTTT
CGACGGAGCTCGTGGGATTTATACTCGCTTGTCACGGTGTCCGGGGCATTCTTGGCAACTCTGGCCCTCCTGATA
GCTGACACCAGGGCAGAGACCTATGTTCAGCTCCACAAATTCTTTCTTGTTGCCATTGTTCTCCTGCTGATACCG
CGCAACGACGCGCTGGATCAACTTTTTAAGACGGCAGCGGCGAGCTTGACCGTCATCGGAAACCTGCTGGCCACT
TGGCTTGTTCTCTTTCTTGTATTCGCCATCGCCATGACACAGACCTTTAGCTTAACCCGCTTCGGGGGCGAGGAA
ACGGGAAATGTCAACTTCCGCACGGTCCCCAAGGCCTTGATACTCTTGTTCCGAATGAGCCTCGGCGAGGGCTGG
AACAAAGTCATGGAAGATTACGCCGAAATTGAACCACCGCTGTGCGTCGAGCAACACAGATTCTTCAACAGTGAC
TGCGGCAGCAAGGCTTGGGCCAGGTTCCTGTTCGTATCATGGAATATTGTGAGCATGTACATATTTGTCAACCTG
TTCGTCTCCCTCATCTACGAGAGTTTCAGTTACGTCTACCAACGATCCAGCGGCGTGGCAGTGGTCGATCGAGAG
GAGATACGCCGTTTCAAGGAAGCCTGGCGCAGCGTGGATCCCGCAGGGACGGGTTTCATCACCAAGGAAGCATTT
CCGCGTCTTCTCGGCGAACTTTCGGGCGTCTTCCAGATGCGAATATATGAGCCACAGGACTCGGTGAGACAGATA
TTGGAAGACGTGCGCGGCGAAGGTCGGACTTCGCATGCGCGGAATATGTCAACGAGGGCTTCCGAAGAAATTGAT
CTGAAAAAGCTGAGAAAGAGATTGAACTTGCTGGACGTGGAAGGAATCCAGAAAAGGCGACGGCGGTTTAAAATT
TTTTACGGAGAGGTATTGGCATCTGCCGATCCAGACAAAGGTGTTGCCTTCCCAGACGTTTTAATGATTCTGGCG
CATTACAACATTATCAATGACAGCAAAAGCCTCAGGTATGTGACGAAGAGCTCTGGCGGGAACCTATGCTCATGC
TTCGACACTGACACTGTCTCGTCTTAGGCTTGCCGAGTTTCTTCGCCGCAGAGCGCGGCTGCAGCGCGTAGACGA
GGAGATACGGCGCAAGATCGTCCAGGGCTTCTTCGACACGCTGTTAGTCAACCGCAGAACTCCGCCCCCCCCCCC
AAGAGCCAGACTGACTGAAATCGGCACAGATATTGGAGTAGAAAGTTCAAGAAGCACATGGAACGCAAACGGACG
GCACGAATGTCAGGGGTGCCGGGAATGCCGGTTCCAGACATTTTTGCCGACGATGATCACAGAGATGACATGTCG
AAGCCGTTTGGTTCCGAGCAAGCGTCTGCCACACGATGGACGCACTTGAGCGTTGGTGAAGGGGCCATGCGTAAT
ACGACGACGAGCGAGGCGGAAGTACACCAAGGCGGGACAGGATACCAACACCCTCTGAGCCATTCTCGATCATCG
ACGTGCACGGCGACGGCGACGGGCCAGGGTGCCGCTTCAGGATTCAGCTTCGAGATATACGAGCCTGAAAGTCGA
CATCAGGGGCAAGATGGATGGGATGAGAGTCGTATAGAGAGCGCAATGAGCCCGTCGCAAGCCCGGCACATTGTG
GACGATTCGGTTTGGGTTGACAGCATCAGACGCAGTTCCACGCTTCGCAGGTCCGCCAGGGGCTCGAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail