Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00085
Gene name
Locationscaffold_01:434782..435289
Strand+
Gene length (bp)507
Transcript length (bp)405
Coding sequence length (bp)405
Protein length (aa) 135

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16211 Histone_H2A_C C-terminus of histone H2A 3.3E-21 94 128
PF00125 Histone Core histone H2A/H2B/H3/H4 5.6E-15 14 91
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 2.9E-05 28 90

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3775 0.6103 0.0372 0.099 0.1748 0.0137 0.0575 0.1435 0.0272 0.0135

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5348
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2954
Ophiocordyceps australis map64 (Brazil) OphauB2|5811
Ophiocordyceps camponoti-floridani Ophcf2|00085 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7435
Ophiocordyceps kimflemingae Ophio5|676
Ophiocordyceps subramaniannii Hirsu2|5176

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00085
MTGGGKSGGKASGSKNAQSRSSKAGLAFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLAAEILELAGNAARD
NKKTRIIPRHLQLAIRNDEELNKLLGHVTIAQGGVLPNIHQNLLPKKTGKSGKGASQEL*
Coding >Ophcf2|00085
ATGACAGGCGGTGGTAAATCCGGCGGCAAGGCCTCCGGCTCCAAGAACGCCCAATCGCGCTCTTCCAAGGCTGGG
CTAGCATTCCCCGTTGGCCGTGTGCATCGTCTCCTTCGCAAAGGCAACTATGCTCAACGCGTCGGTGCCGGTGCT
CCTGTCTATCTCGCGGCAGTCCTGGAATACCTCGCTGCCGAAATCCTCGAACTCGCCGGTAACGCTGCTCGTGAC
AACAAGAAGACGCGTATCATACCTCGTCATCTGCAGCTAGCCATCCGCAACGACGAAGAACTCAACAAGCTCCTA
GGCCACGTCACAATTGCGCAAGGAGGAGTTCTTCCCAACATTCACCAGAATCTGCTCCCAAAAAAGACAGGAAAG
AGCGGCAAGGGCGCGAGTCAGGAACTGTGA
Transcript >Ophcf2|00085
ATGACAGGCGGTGGTAAATCCGGCGGCAAGGCCTCCGGCTCCAAGAACGCCCAATCGCGCTCTTCCAAGGCTGGG
CTAGCATTCCCCGTTGGCCGTGTGCATCGTCTCCTTCGCAAAGGCAACTATGCTCAACGCGTCGGTGCCGGTGCT
CCTGTCTATCTCGCGGCAGTCCTGGAATACCTCGCTGCCGAAATCCTCGAACTCGCCGGTAACGCTGCTCGTGAC
AACAAGAAGACGCGTATCATACCTCGTCATCTGCAGCTAGCCATCCGCAACGACGAAGAACTCAACAAGCTCCTA
GGCCACGTCACAATTGCGCAAGGAGGAGTTCTTCCCAACATTCACCAGAATCTGCTCCCAAAAAAGACAGGAAAG
AGCGGCAAGGGCGCGAGTCAGGAACTGTGA
Gene >Ophcf2|00085
ATGACAGGCGGTGGTAAATCCGGCGGCAAGGCCTCCGGCTCCAAGAACGCCCAATCGTAAGTTTTTACTCTCAGA
GGCTTGCGAAACGCATTAATGATGTACCCTAGGCGCTCTTCCAAGGCTGGGCTAGCATTCCCCGTTGGCCGTGTG
CATCGTCTCCTTCGCAAAGGCAACTATGCTCAACGCGTCGGTGCCGGTGCTCCTGTCTATCTCGCGGCAGTCCTG
GAATACCTCGCTGCCGAAATCCTCGAACTCGCCGGTAACGCTGCTCGTGACAACAAGAAGACGCGTATCATACCT
CGTCATCTGCAGCTAGCCATCCGCAACGACGAAGAACTCAACAAGCTCCTAGGCCACGTCACAATTGCGCAAGGA
GGAGTTCTTCCCAACATTCACCAGAGTACGTTTTTTATCTTCATTGGACAGTACGTGACCTAACAGAATTTGTTA
GATCTGCTCCCAAAAAAGACAGGAAAGAGCGGCAAGGGCGCGAGTCAGGAACTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail