Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00075
Gene name
Locationscaffold_01:191113..197785
Strand-
Gene length (bp)6672
Transcript length (bp)5142
Coding sequence length (bp)5142
Protein length (aa) 1714

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00063 Myosin_head Myosin head (motor domain) 2.7E-260 77 770
PF01843 DIL DIL domain 4.7E-27 1377 1475
PF00612 IQ IQ calmodulin-binding motif 5.9E-05 834 853
PF00612 IQ IQ calmodulin-binding motif 1.5E-03 905 925

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0005515 protein binding Yes
GO:0003774 cytoskeletal motor activity Yes
GO:0016459 myosin complex Yes
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5321 0.2387 0.3333 0.1925 0.3471 0.1681 0.3177 0.3302 0.534 0.1006

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2079
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7582
Ophiocordyceps australis map64 (Brazil) OphauB2|3733
Ophiocordyceps camponoti-floridani Ophcf2|00075 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|639
Ophiocordyceps kimflemingae Ophio5|8324
Ophiocordyceps subramaniannii Hirsu2|2406

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00075
MASTYDVGTRAWQPDPTLGWIASELVNKSIEGNKAKLVFKLDNGENKTIEVSAEALQTGNDALLPPLMNPSMLEA
SDDLTNLSHLNEPAVLQAIRLRYVQKEIYTYSGIVLIATNPFARVDSLYVPGMVQVYAGKQRATQAPHLFAIAEE
AFMDMIRDSKNQTIVVSGESGAGKTVSAKYIMRYFATRESPDNPGARSKRGAESMSETEEQILATNPIMEAFGNA
KTTRNDNSSRFGKYIEIMFDKQTNIIGAKIRTYLLERSRLVFQPLKERNYHIFYQLAAGASDEQRRALDLLPVEQ
FEYLSQGDCPTIDGVDDKAEFESTKRSLHTIGVSDAKQSDIFKLLAGLLHLGNVKITASRNDSVLAPTEPSLEKA
CKILGVDATDFAKWIVKKQLITRGEKITSNLSQAQAVVVRDSVAKFVYSSLFDWLVDVINGSLATEEVLNRVSSF
IGVLDIYGFEHFAKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYLREQIDWTFIDFSDNQPCIDLIEGKMGILT
LLDEESRLPMGSDDQFVTKLHNNFAADKQNKFFKKPRFGKSAFTVCHYAVDVTYESEGFIEKNRDTVPDEHMAIL
RSTSNLFLKEVLEAASAVREKDVASASSNAVKPAAGRKIGVAVNRKPTLGGIFRSSLIELMNTINNTDVHYIRCI
KPNEAKEAWRFEGPMVLSQLRACGVLETVRISCAGYPTRWTYEEFALRYYMLVPSSQWTSEIRQMANAILTKALG
TSTGKGLDKYQLGLTKIFFRAGMLAFLENLRTNRLNACAILIQKNLRAKFYRRRYLAARDSVIRTQAIARAYMAR
KRAQELRTHKAATTIQRVWRGQKQRRKYMSIRKDMILFESAAKGYLRRKQIMETRVGNAALVIQRAWRRRTQLRS
WRQYRRKVVLIQSLWRGKSARREYKTVREEARDLKQISYKLENKVVELTQSLGSMKEKNKNLVSQVENYEGQIKS
WKNRHNALEARTKELQTEANQAGIAVAKLQVMEEEMKKLQQAFDESTTSIKRMQDEEKELRESLRVTNSELGTAK
QASSEREKDNISLRQELESLRDALEAAKRSAPINGDLANGASTPAAASGLINLVSSKKPKRRSAGAEPRDLDRFS
GAYNPRPVSMAVTNTAHRQNLSGAAYIPGVDNIEMELESLLADEDGLNEEVTMGLIRNLRIPSPSTTPPPSDKEV
LFPSYLINLVTSEMWNNGFVKESERFLANVMQSIQQEVMQHDGDEAVNPGAFWLSNVHEMLSFVFLAEDWYETQK
TDNYEYDRLLEIVKHDLESLEFNIYHTWMKVLKKKLHKMIIPAIIESQSLPGFITNESNRFLGKLLQSNTAPAYS
MDNLLSLLNSVFRAMKAFYLEDSIITQTVTELLRLVGVTAFNDLLMRRNFLSWKRGLQINYNITRIEEWCKSHDM
PEGTLQLEHLMQATKLLQLKKATLNDIEIIQDICWMLSPNQIQKLLNQYLVADYEQPINGEIMKAVASRVTEKSD
VLLLQAVDMEDSGPYEIAEPRSITALETYTPSWLQTPRLKRLAEIVSAQAIAQQEKLEYADGPDGNGTLEEADET
SAEGATAVVEQCGLSQPDTHTRQTYEAFTMPPHRIPKLPRARPSEMLCMGAAGVGVLTPLYLVMPGAEERLARQT
TKWAPRWERNISFFAPPVERTVRRLEAPVARAVRRVEGRLPLESMAKRVDAGIRRVWPPRPAA*
Coding >Ophcf2|00075
ATGGCATCGACCTACGATGTTGGCACGCGAGCTTGGCAGCCTGACCCAACGTTGGGATGGATAGCCTCCGAACTT
GTCAACAAATCAATTGAAGGCAACAAGGCGAAACTCGTTTTCAAGCTCGACAATGGCGAGAACAAGACGATCGAG
GTCTCCGCTGAGGCGCTGCAAACCGGTAACGATGCGCTGTTACCGCCTTTGATGAATCCATCCATGCTCGAAGCC
AGCGATGACCTTACGAACCTGTCCCATCTCAATGAACCTGCCGTGTTGCAGGCTATTCGACTGCGCTACGTGCAG
AAAGAGATTTACACCTACAGCGGCATCGTGCTCATCGCAACTAATCCGTTTGCACGCGTCGACTCTCTCTACGTT
CCCGGGATGGTTCAGGTCTACGCTGGAAAGCAGAGAGCAACTCAGGCGCCTCATCTGTTTGCCATTGCTGAAGAG
GCTTTCATGGACATGATCCGGGACAGCAAGAACCAGACCATTGTTGTTTCCGGAGAATCGGGCGCCGGCAAGACG
GTCAGCGCGAAATACATTATGCGTTATTTCGCTACCAGGGAGTCCCCAGACAACCCCGGTGCCCGCTCCAAACGG
GGAGCGGAGTCGATGAGCGAGACGGAAGAGCAGATCCTTGCCACCAACCCCATCATGGAGGCTTTCGGCAACGCC
AAGACTACGCGCAACGACAACTCTTCCAGGTTCGGCAAGTACATCGAGATCATGTTTGACAAGCAGACGAACATC
ATCGGTGCCAAAATTCGAACATATCTTTTGGAACGGTCACGGTTGGTCTTTCAGCCTCTGAAAGAACGCAACTAC
CACATCTTCTATCAGCTTGCTGCTGGCGCCTCTGATGAACAGCGTCGAGCGCTAGATCTGCTTCCTGTTGAGCAG
TTTGAGTACCTCAGCCAAGGAGACTGCCCGACCATTGACGGTGTCGACGACAAGGCCGAGTTTGAATCGACAAAG
AGATCGCTTCATACTATTGGCGTATCGGATGCCAAACAATCGGACATTTTTAAACTGTTGGCCGGTCTACTTCAC
CTTGGCAATGTCAAAATCACGGCTTCGCGGAACGACAGCGTCCTCGCACCGACCGAACCATCATTGGAAAAGGCC
TGTAAAATTCTTGGTGTGGACGCAACCGACTTCGCCAAGTGGATCGTCAAGAAGCAGCTGATCACCCGAGGTGAG
AAGATCACTTCTAACCTGAGCCAGGCCCAGGCCGTGGTCGTGCGTGATTCGGTCGCAAAATTCGTCTATTCCAGC
TTGTTCGATTGGCTGGTAGACGTCATCAATGGCAGTCTCGCTACCGAAGAAGTATTGAATCGCGTCTCCTCCTTC
ATCGGCGTCTTGGACATATACGGCTTCGAGCACTTCGCCAAGAATTCCTTTGAGCAGTTCTGTATAAACTATGCG
AACGAGAAGTTGCAGCAAGAGTTCAACCAGCACGTCTTCAAACTTGAGCAGGAGGAGTACCTTCGAGAGCAAATT
GACTGGACCTTTATTGACTTTTCTGACAACCAGCCCTGCATCGATCTCATCGAAGGGAAAATGGGCATCCTGACC
TTATTGGACGAGGAATCACGACTTCCCATGGGCTCGGATGACCAATTTGTCACGAAGCTTCATAACAACTTCGCC
GCCGACAAACAAAACAAGTTCTTCAAGAAACCTAGGTTTGGAAAATCGGCATTCACCGTCTGTCACTACGCTGTG
GATGTCACGTATGAGTCAGAGGGCTTTATCGAGAAGAATAGGGATACTGTCCCCGATGAGCACATGGCCATCTTG
CGGTCGACGAGCAACCTGTTCCTCAAGGAAGTCTTGGAAGCAGCGTCCGCTGTCAGAGAGAAGGATGTTGCTTCG
GCATCCTCCAACGCTGTCAAGCCCGCGGCTGGGCGAAAAATCGGCGTTGCTGTCAACAGGAAACCAACGCTCGGT
GGAATCTTCCGGTCGTCGCTGATTGAGCTCATGAATACGATCAACAACACAGACGTTCACTACATCCGATGTATC
AAGCCCAACGAAGCCAAGGAAGCGTGGCGATTCGAGGGTCCCATGGTTCTCAGCCAACTACGAGCCTGCGGTGTC
TTGGAGACGGTTCGCATCAGCTGCGCCGGATATCCCACGCGTTGGACATACGAGGAGTTCGCTCTCAGATACTAT
ATGCTTGTTCCGTCTAGCCAGTGGACCTCTGAGATTCGCCAGATGGCCAACGCCATCCTGACCAAGGCGCTTGGC
ACCAGCACGGGCAAAGGCCTGGACAAGTATCAACTGGGCCTTACCAAGATCTTCTTCCGGGCCGGCATGCTCGCT
TTTCTGGAAAACCTGCGGACGAATCGTCTCAATGCCTGCGCGATCCTGATCCAGAAGAACCTCAGGGCCAAGTTC
TACCGCCGTCGCTACTTGGCCGCCCGGGATTCTGTTATACGCACGCAAGCAATCGCGAGGGCATATATGGCGAGA
AAGCGAGCCCAGGAGCTGCGGACTCACAAGGCTGCCACTACGATTCAACGCGTGTGGCGCGGTCAGAAGCAGCGC
CGCAAGTACATGTCCATCAGGAAAGACATGATACTGTTCGAGTCGGCTGCCAAGGGCTACCTTCGGAGAAAGCAG
ATCATGGAGACCCGAGTGGGCAACGCTGCGCTCGTCATACAGAGAGCCTGGAGGAGACGGACGCAGCTGCGGTCT
TGGCGACAGTACCGACGCAAGGTGGTCCTCATCCAGAGCTTATGGCGTGGAAAGAGTGCTCGCAGGGAGTACAAG
ACGGTCCGCGAGGAGGCCCGCGACCTGAAGCAAATCTCGTACAAGCTTGAAAACAAGGTCGTCGAACTCACCCAA
TCCCTGGGCTCCATGAAGGAGAAGAACAAGAACCTTGTGTCCCAGGTCGAGAACTACGAGGGTCAGATCAAGTCG
TGGAAGAACCGCCACAACGCTCTCGAGGCACGGACCAAGGAGTTGCAGACGGAGGCCAACCAGGCGGGCATCGCC
GTCGCCAAGCTTCAGGTGATGGAGGAGGAGATGAAGAAACTCCAGCAAGCCTTTGATGAGTCGACGACGAGCATC
AAGCGGATGCAGGACGAAGAGAAAGAACTTCGCGAGTCTCTGCGGGTGACAAACTCGGAGCTGGGAACGGCGAAG
CAGGCCAGCAGTGAACGTGAGAAGGACAACATCAGTCTCCGGCAAGAGCTCGAGTCCCTGAGGGACGCGCTCGAG
GCTGCCAAGAGGAGCGCGCCCATCAACGGGGACCTTGCCAACGGAGCTTCGACACCCGCAGCCGCCTCTGGACTC
ATCAACCTCGTGTCGTCCAAGAAGCCGAAGCGCAGGAGCGCCGGGGCGGAGCCACGGGATCTGGATCGCTTCAGC
GGTGCCTACAATCCTCGACCCGTTTCCATGGCCGTGACCAATACGGCTCATCGGCAGAACTTGTCGGGTGCGGCC
TACATCCCTGGCGTCGACAATATCGAGATGGAGTTGGAGAGTCTTTTGGCGGACGAGGACGGCCTCAACGAAGAG
GTGACGATGGGTCTTATCCGCAACCTCCGCATCCCCTCACCCAGCACTACACCGCCGCCTTCTGACAAGGAGGTT
CTCTTCCCGTCCTATCTCATCAACCTGGTGACGTCGGAGATGTGGAACAACGGCTTTGTGAAGGAGTCGGAGAGG
TTCCTGGCCAACGTGATGCAGTCGATCCAACAGGAAGTGATGCAACACGACGGTGATGAAGCCGTCAATCCTGGT
GCTTTCTGGTTGTCAAACGTCCACGAGATGTTGTCGTTTGTCTTCCTCGCGGAAGACTGGTACGAGACTCAGAAG
ACGGACAACTACGAGTACGACCGGCTCTTGGAGATCGTCAAACACGACCTGGAAAGCCTCGAATTCAACATTTAC
CACACGTGGATGAAGGTGCTGAAGAAGAAGCTGCACAAGATGATTATCCCGGCAATCATCGAATCGCAGTCGCTT
CCGGGCTTCATCACCAACGAGAGCAACCGCTTCCTCGGCAAGCTCTTGCAGTCCAACACGGCACCGGCCTATAGC
ATGGACAATCTGCTCAGTCTCCTCAACAGCGTTTTCCGAGCGATGAAGGCCTTCTATCTCGAAGACTCCATCATC
ACACAGACTGTGACGGAACTCCTGAGGCTAGTTGGCGTGACGGCATTCAACGACTTGCTGATGCGTCGGAACTTC
CTTTCGTGGAAGCGAGGTCTTCAGATCAACTACAACATCACTCGTATCGAGGAGTGGTGCAAGAGCCACGACATG
CCTGAAGGGACGCTGCAGCTGGAGCATCTGATGCAGGCGACGAAGCTTCTCCAGCTGAAGAAGGCGACGCTCAAC
GACATTGAAATCATCCAGGACATCTGCTGGATGCTATCGCCGAACCAGATCCAAAAGCTGCTGAACCAGTACCTG
GTGGCAGACTACGAGCAGCCCATAAACGGAGAGATTATGAAGGCCGTCGCGTCGCGGGTCACGGAGAAGAGCGAC
GTACTGCTTCTTCAAGCGGTAGACATGGAGGACAGCGGCCCTTATGAGATTGCCGAGCCGCGGTCCATCACGGCG
CTGGAGACGTATACACCTTCGTGGCTGCAAACGCCACGGCTGAAGCGCTTGGCCGAGATCGTGTCGGCACAGGCC
ATTGCGCAGCAAGAGAAGCTCGAGTACGCCGACGGCCCGGACGGTAACGGGACTCTGGAAGAGGCCGACGAGACG
AGTGCCGAAGGAGCGACGGCCGTTGTCGAGCAGTGTGGGTTGAGCCAGCCAGACACACATACAAGACAAACATAC
GAAGCTTTCACCATGCCTCCTCACCGTATCCCTAAGCTCCCCCGCGCCAGACCGTCCGAGATGCTCTGCATGGGC
GCCGCCGGCGTCGGCGTTCTCACTCCGCTCTACCTCGTCATGCCCGGCGCCGAGGAGCGCCTGGCCCGCCAGACG
ACAAAGTGGGCTCCTCGCTGGGAGCGCAACATCTCCTTCTTCGCTCCGCCCGTCGAGCGCACCGTTCGCCGGCTG
GAGGCCCCCGTTGCCCGTGCTGTTCGGCGGGTAGAGGGTCGGTTACCGCTCGAGAGCATGGCCAAGCGCGTCGAC
GCTGGCATCCGTCGCGTTTGGCCGCCAAGACCGGCTGCTTGA
Transcript >Ophcf2|00075
ATGGCATCGACCTACGATGTTGGCACGCGAGCTTGGCAGCCTGACCCAACGTTGGGATGGATAGCCTCCGAACTT
GTCAACAAATCAATTGAAGGCAACAAGGCGAAACTCGTTTTCAAGCTCGACAATGGCGAGAACAAGACGATCGAG
GTCTCCGCTGAGGCGCTGCAAACCGGTAACGATGCGCTGTTACCGCCTTTGATGAATCCATCCATGCTCGAAGCC
AGCGATGACCTTACGAACCTGTCCCATCTCAATGAACCTGCCGTGTTGCAGGCTATTCGACTGCGCTACGTGCAG
AAAGAGATTTACACCTACAGCGGCATCGTGCTCATCGCAACTAATCCGTTTGCACGCGTCGACTCTCTCTACGTT
CCCGGGATGGTTCAGGTCTACGCTGGAAAGCAGAGAGCAACTCAGGCGCCTCATCTGTTTGCCATTGCTGAAGAG
GCTTTCATGGACATGATCCGGGACAGCAAGAACCAGACCATTGTTGTTTCCGGAGAATCGGGCGCCGGCAAGACG
GTCAGCGCGAAATACATTATGCGTTATTTCGCTACCAGGGAGTCCCCAGACAACCCCGGTGCCCGCTCCAAACGG
GGAGCGGAGTCGATGAGCGAGACGGAAGAGCAGATCCTTGCCACCAACCCCATCATGGAGGCTTTCGGCAACGCC
AAGACTACGCGCAACGACAACTCTTCCAGGTTCGGCAAGTACATCGAGATCATGTTTGACAAGCAGACGAACATC
ATCGGTGCCAAAATTCGAACATATCTTTTGGAACGGTCACGGTTGGTCTTTCAGCCTCTGAAAGAACGCAACTAC
CACATCTTCTATCAGCTTGCTGCTGGCGCCTCTGATGAACAGCGTCGAGCGCTAGATCTGCTTCCTGTTGAGCAG
TTTGAGTACCTCAGCCAAGGAGACTGCCCGACCATTGACGGTGTCGACGACAAGGCCGAGTTTGAATCGACAAAG
AGATCGCTTCATACTATTGGCGTATCGGATGCCAAACAATCGGACATTTTTAAACTGTTGGCCGGTCTACTTCAC
CTTGGCAATGTCAAAATCACGGCTTCGCGGAACGACAGCGTCCTCGCACCGACCGAACCATCATTGGAAAAGGCC
TGTAAAATTCTTGGTGTGGACGCAACCGACTTCGCCAAGTGGATCGTCAAGAAGCAGCTGATCACCCGAGGTGAG
AAGATCACTTCTAACCTGAGCCAGGCCCAGGCCGTGGTCGTGCGTGATTCGGTCGCAAAATTCGTCTATTCCAGC
TTGTTCGATTGGCTGGTAGACGTCATCAATGGCAGTCTCGCTACCGAAGAAGTATTGAATCGCGTCTCCTCCTTC
ATCGGCGTCTTGGACATATACGGCTTCGAGCACTTCGCCAAGAATTCCTTTGAGCAGTTCTGTATAAACTATGCG
AACGAGAAGTTGCAGCAAGAGTTCAACCAGCACGTCTTCAAACTTGAGCAGGAGGAGTACCTTCGAGAGCAAATT
GACTGGACCTTTATTGACTTTTCTGACAACCAGCCCTGCATCGATCTCATCGAAGGGAAAATGGGCATCCTGACC
TTATTGGACGAGGAATCACGACTTCCCATGGGCTCGGATGACCAATTTGTCACGAAGCTTCATAACAACTTCGCC
GCCGACAAACAAAACAAGTTCTTCAAGAAACCTAGGTTTGGAAAATCGGCATTCACCGTCTGTCACTACGCTGTG
GATGTCACGTATGAGTCAGAGGGCTTTATCGAGAAGAATAGGGATACTGTCCCCGATGAGCACATGGCCATCTTG
CGGTCGACGAGCAACCTGTTCCTCAAGGAAGTCTTGGAAGCAGCGTCCGCTGTCAGAGAGAAGGATGTTGCTTCG
GCATCCTCCAACGCTGTCAAGCCCGCGGCTGGGCGAAAAATCGGCGTTGCTGTCAACAGGAAACCAACGCTCGGT
GGAATCTTCCGGTCGTCGCTGATTGAGCTCATGAATACGATCAACAACACAGACGTTCACTACATCCGATGTATC
AAGCCCAACGAAGCCAAGGAAGCGTGGCGATTCGAGGGTCCCATGGTTCTCAGCCAACTACGAGCCTGCGGTGTC
TTGGAGACGGTTCGCATCAGCTGCGCCGGATATCCCACGCGTTGGACATACGAGGAGTTCGCTCTCAGATACTAT
ATGCTTGTTCCGTCTAGCCAGTGGACCTCTGAGATTCGCCAGATGGCCAACGCCATCCTGACCAAGGCGCTTGGC
ACCAGCACGGGCAAAGGCCTGGACAAGTATCAACTGGGCCTTACCAAGATCTTCTTCCGGGCCGGCATGCTCGCT
TTTCTGGAAAACCTGCGGACGAATCGTCTCAATGCCTGCGCGATCCTGATCCAGAAGAACCTCAGGGCCAAGTTC
TACCGCCGTCGCTACTTGGCCGCCCGGGATTCTGTTATACGCACGCAAGCAATCGCGAGGGCATATATGGCGAGA
AAGCGAGCCCAGGAGCTGCGGACTCACAAGGCTGCCACTACGATTCAACGCGTGTGGCGCGGTCAGAAGCAGCGC
CGCAAGTACATGTCCATCAGGAAAGACATGATACTGTTCGAGTCGGCTGCCAAGGGCTACCTTCGGAGAAAGCAG
ATCATGGAGACCCGAGTGGGCAACGCTGCGCTCGTCATACAGAGAGCCTGGAGGAGACGGACGCAGCTGCGGTCT
TGGCGACAGTACCGACGCAAGGTGGTCCTCATCCAGAGCTTATGGCGTGGAAAGAGTGCTCGCAGGGAGTACAAG
ACGGTCCGCGAGGAGGCCCGCGACCTGAAGCAAATCTCGTACAAGCTTGAAAACAAGGTCGTCGAACTCACCCAA
TCCCTGGGCTCCATGAAGGAGAAGAACAAGAACCTTGTGTCCCAGGTCGAGAACTACGAGGGTCAGATCAAGTCG
TGGAAGAACCGCCACAACGCTCTCGAGGCACGGACCAAGGAGTTGCAGACGGAGGCCAACCAGGCGGGCATCGCC
GTCGCCAAGCTTCAGGTGATGGAGGAGGAGATGAAGAAACTCCAGCAAGCCTTTGATGAGTCGACGACGAGCATC
AAGCGGATGCAGGACGAAGAGAAAGAACTTCGCGAGTCTCTGCGGGTGACAAACTCGGAGCTGGGAACGGCGAAG
CAGGCCAGCAGTGAACGTGAGAAGGACAACATCAGTCTCCGGCAAGAGCTCGAGTCCCTGAGGGACGCGCTCGAG
GCTGCCAAGAGGAGCGCGCCCATCAACGGGGACCTTGCCAACGGAGCTTCGACACCCGCAGCCGCCTCTGGACTC
ATCAACCTCGTGTCGTCCAAGAAGCCGAAGCGCAGGAGCGCCGGGGCGGAGCCACGGGATCTGGATCGCTTCAGC
GGTGCCTACAATCCTCGACCCGTTTCCATGGCCGTGACCAATACGGCTCATCGGCAGAACTTGTCGGGTGCGGCC
TACATCCCTGGCGTCGACAATATCGAGATGGAGTTGGAGAGTCTTTTGGCGGACGAGGACGGCCTCAACGAAGAG
GTGACGATGGGTCTTATCCGCAACCTCCGCATCCCCTCACCCAGCACTACACCGCCGCCTTCTGACAAGGAGGTT
CTCTTCCCGTCCTATCTCATCAACCTGGTGACGTCGGAGATGTGGAACAACGGCTTTGTGAAGGAGTCGGAGAGG
TTCCTGGCCAACGTGATGCAGTCGATCCAACAGGAAGTGATGCAACACGACGGTGATGAAGCCGTCAATCCTGGT
GCTTTCTGGTTGTCAAACGTCCACGAGATGTTGTCGTTTGTCTTCCTCGCGGAAGACTGGTACGAGACTCAGAAG
ACGGACAACTACGAGTACGACCGGCTCTTGGAGATCGTCAAACACGACCTGGAAAGCCTCGAATTCAACATTTAC
CACACGTGGATGAAGGTGCTGAAGAAGAAGCTGCACAAGATGATTATCCCGGCAATCATCGAATCGCAGTCGCTT
CCGGGCTTCATCACCAACGAGAGCAACCGCTTCCTCGGCAAGCTCTTGCAGTCCAACACGGCACCGGCCTATAGC
ATGGACAATCTGCTCAGTCTCCTCAACAGCGTTTTCCGAGCGATGAAGGCCTTCTATCTCGAAGACTCCATCATC
ACACAGACTGTGACGGAACTCCTGAGGCTAGTTGGCGTGACGGCATTCAACGACTTGCTGATGCGTCGGAACTTC
CTTTCGTGGAAGCGAGGTCTTCAGATCAACTACAACATCACTCGTATCGAGGAGTGGTGCAAGAGCCACGACATG
CCTGAAGGGACGCTGCAGCTGGAGCATCTGATGCAGGCGACGAAGCTTCTCCAGCTGAAGAAGGCGACGCTCAAC
GACATTGAAATCATCCAGGACATCTGCTGGATGCTATCGCCGAACCAGATCCAAAAGCTGCTGAACCAGTACCTG
GTGGCAGACTACGAGCAGCCCATAAACGGAGAGATTATGAAGGCCGTCGCGTCGCGGGTCACGGAGAAGAGCGAC
GTACTGCTTCTTCAAGCGGTAGACATGGAGGACAGCGGCCCTTATGAGATTGCCGAGCCGCGGTCCATCACGGCG
CTGGAGACGTATACACCTTCGTGGCTGCAAACGCCACGGCTGAAGCGCTTGGCCGAGATCGTGTCGGCACAGGCC
ATTGCGCAGCAAGAGAAGCTCGAGTACGCCGACGGCCCGGACGGTAACGGGACTCTGGAAGAGGCCGACGAGACG
AGTGCCGAAGGAGCGACGGCCGTTGTCGAGCAGTGTGGGTTGAGCCAGCCAGACACACATACAAGACAAACATAC
GAAGCTTTCACCATGCCTCCTCACCGTATCCCTAAGCTCCCCCGCGCCAGACCGTCCGAGATGCTCTGCATGGGC
GCCGCCGGCGTCGGCGTTCTCACTCCGCTCTACCTCGTCATGCCCGGCGCCGAGGAGCGCCTGGCCCGCCAGACG
ACAAAGTGGGCTCCTCGCTGGGAGCGCAACATCTCCTTCTTCGCTCCGCCCGTCGAGCGCACCGTTCGCCGGCTG
GAGGCCCCCGTTGCCCGTGCTGTTCGGCGGGTAGAGGGTCGGTTACCGCTCGAGAGCATGGCCAAGCGCGTCGAC
GCTGGCATCCGTCGCGTTTGGCCGCCAAGACCGGCTGCTTGA
Gene >Ophcf2|00075
ATGGCATCGACCTACGATGTTGGCACGCGAGCTTGGCAGCCTGACCCAACGTTGGGATGGATAGCCTCCGAACTT
GTCAACAAATCAATTGAAGGCAACAAGGCGAAACTCGTTTTCAAGCTCGACAATGGCGAGGTAAAGTCTCTTTTC
TGTCCAAGTCTCTGCGCGAAGTCGTTGAAGCTAACGCGCAAGTTGTCCAACTGCACAGAACAAGACGATCGAGGT
CTCCGCTGAGGCGCTGCAAACCGGTAACGATGCGCTGTTACCGCCTTTGATGAATCCATCCATGCTCGAAGCCAG
CGATGACCTTACGAACCTGTCCCATCTCAATGAACCTGCCGGTAAGATTCCGCTCTTCTCCCCTTTGCGCTGTGC
GAGATCCGAAGGTGGGCTCTGACGGTGTTGAATAGTGTTGCAGGCTATTCGACTGCGCTACGTGCAGAAAGAGAT
TTACACCTACAGCGGCATCGTGCTCATCGCAACTAATCCGTTTGCACGCGTCGACTCTCTCTACGTTCCCGGGAT
GGTTCAGGTCTACGCTGGAAAGCAGAGAGCAACTCAGGCGCCTCATCTGTTTGCCATTGCTGAAGAGGCTTTCAT
GTGAGTTGGCCAACTGAGGATTTCATGCGAATCAATCATGTTGCTGACGTGGAAGCAGGGACATGATCCGGGACA
GCAAGAACCAGACCATTGTTGTTTCCGGAGAATCGGGCGCCGGCAAGACGGTCAGCGCGAAATACATTATGCGTT
ATTTCGCTACCAGGGAGTCCCCAGACAACCCCGGTGCCCGCTCCAAACGGGGAGCGGAGTCGATGAGCGAGACGG
AAGAGCAGATCCTTGCCACCAACCCCATCATGGAGGCTTTCGGCAACGCCAAGACTACGCGCAACGACAACTCTT
CCAGGTTCGGCAAGTACATCGAGATCATGTTTGACAAGCAGACGAACATCATCGGTGCCAAAATTCGAACATATC
TTTTGGAACGGTCACGGTTGGTCTTTCAGCCTCTGAAAGAACGCAACTACCACATCTTCTATCAGCTTGCTGCTG
GCGCCTCTGATGAACAGCGTCGAGCGCTAGATCTGCTTCCTGTTGAGCAGTTTGAGTACCTCAGCCAAGGAGACT
GCCCGACCATTGACGGTGTCGACGACAAGGCCGAGTTTGAATCGACAAAGAGATCGCTTCATACTATTGGCGTAT
CGGATGCCAAACAATCGGACATTTTTAAACTGTTGGCCGGTCTACTTCACCTTGGCAATGTCAAAATCACGGCTT
CGCGGAACGACAGCGTCCTCGCACCGACCGAACCATCATTGGAAAAGGCCTGTAAAATTCTTGGTGTGGACGCAA
CCGACTTCGCCAAGTGGATCGTCAAGAAGCAGCTGATCACCCGAGGTGAGAAGATCACTTCTAACCTGAGCCAGG
CCCAGGCCGTGGTCGTGCGTGATTCGGTCGCAAAATTCGTCTATTCCAGCTTGTTCGATTGGCTGGTAGACGTCA
TCAATGGCAGTCTCGCTACCGAAGAAGTATTGAATCGCGTCTCCTCCTTCATCGGCGTCTTGGACATATACGGCT
TCGAGCACTTCGCCAAGAATTCCTTTGAGCAGTTCTGTATAAACTATGCGAACGAGAAGTTGCAGCAAGAGTTCA
ACCAGCACGTCTTCAAACTTGAGCAGGAGGAGTACCTTCGAGAGCAAATTGACTGGACCTTTATTGACTTTTCTG
ACAACCAGCCCTGCATCGATCTCATCGAAGGGAAAATGGGCATCCTGACCTTATTGGACGAGGAATCACGACTTC
CCATGGGCTCGGATGACCAATTTGTCACGAAGCTTCATAACAACTTCGCCGCCGACAAACAAAACAAGTTCTTCA
AGAAACCTAGGTTTGGAAAATCGGCATTCACCGTCTGTCACTACGCTGTGGATGTCACGTATGAGTCAGAGGGCT
TTATCGAGAAGAATAGGGATACTGTCCCCGATGAGCACATGGCCATCTTGCGGTCGACGAGCAACCTGTTCCTCA
AGGAAGTCTTGGAAGCAGCGTCCGCTGTCAGAGAGAAGGATGTTGCTTCGGCATCCTCCAACGCTGTCAAGCCCG
CGGCTGGGCGAAAAATCGGCGTTGCTGTCAACAGGAAACCAACGCTCGGTGGAATCTTCCGGTCGTCGCTGATTG
AGCTCATGAATACGATCAACAACACAGACGTTCACTACATCCGATGTATCAAGCCCAACGAAGCCAAGGAAGCGT
GGCGATTCGAGGGTCCCATGGTTCTCAGCCAACTACGAGCCTGCGGTGTCTTGGAGACGGTTCGCATCAGCTGCG
CCGGATATCCCACGCGTTGGACATACGAGGAGTTCGCTCTCAGATACTATATGCTTGTTCCGTCTAGCCAGTGGA
CCTCTGAGATTCGCCAGATGGCCAACGCCATCCTGACCAAGGCGCTTGGCACCAGCACGGGCAAAGGCCTGGACA
AGTATCAACTGGGCCTTACCAAGATCTTCTTCCGGGCCGGCATGCTCGCTTTTCTGGAAAACCTGCGGACGAATC
GTCTCAATGCCTGCGCGATCCTGATCCAGAAGAACCTCAGGGCCAAGTTCTACCGCCGTCGCTACTTGGCCGCCC
GGGATTCTGTTATACGCACGCAAGCAATCGCGAGGGCATATATGGCGAGAAAGCGAGCCCAGGAGCTGCGGACTC
ACAAGGCTGCCACTACGATTCAACGCGTGTGGCGCGGTCAGAAGCAGCGCCGCAAGTACATGTCCATCAGGAAAG
ACATGATACTGTTCGAGTCGGCTGCCAAGGGCTACCTTCGGAGAAAGCAGATCATGGAGACCCGAGTGGGCAACG
CTGCGCTCGTCATACAGAGAGCCTGGAGGAGACGGACGCAGCTGCGGTCTTGGCGACAGTACCGACGCAAGGTGG
TCCTCATCCAGAGCTTATGGCGTGGAAAGAGTGCTCGCAGGGAGTACAAGACGGTCCGCGAGGAGGCCCGCGACC
TGAAGCAAATCTCGTACAAGCTTGAAAACAAGGTCGTCGAACTCACCCAATCCCTGGGCTCCATGAAGGAGAAGA
ACAAGAACCTTGTGTCCCAGGTCGAGAACTACGAGGGTCAGATCAAGTCGTGGAAGAACCGCCACAACGCTCTCG
AGGCACGGACCAAGGAGTTGCAGACGGAGGCCAACCAGGCGGGCATCGCCGTCGCCAAGCTTCAGGTGATGGAGG
AGGAGATGAAGAAACTCCAGCAAGCCTTTGATGAGTCGACGACGAGCATCAAGCGGATGCAGGACGAAGAGAAAG
AACTTCGCGAGTCTCTGCGGGTGACAAACTCGGAGCTGGGAACGGCGAAGCAGGCCAGCAGTGAACGTGAGAAGG
ACAACATCAGTCTCCGGCAAGAGCTCGAGTCCCTGAGGGACGCGCTCGAGGCTGCCAAGAGGAGCGCGCCCATCA
ACGGGGACCTTGCCAACGGAGCTTCGACACCCGCAGCCGCCTCTGGACTCATCAACCTCGTGTCGTCCAAGAAGC
CGAAGCGCAGGAGCGCCGGGGCGGAGCCACGGGATCTGGATCGCTTCAGCGGTGCCTACAATCCTCGACCCGTTT
CCATGGCCGTGACCAATACGGCTCATCGGCAGAACTTGTCGGGTGCGGCCTACATCCCTGGCGTCGACAATATCG
AGATGGAGTTGGAGAGTCTTTTGGCGGACGAGGACGGCCTCAACGAAGAGGTGACGATGGGTCTTATCCGCAACC
TCCGCATCCCCTCACCCAGCACTACACCGCCGCCTTCTGACAAGGAGGTTCTCTTCCCGTCCTATCTCATCAACC
TGGTGACGTCGGAGATGTGGAACAACGGCTTTGTGAAGGAGTCGGAGAGGTTCCTGGCCAACGTGATGCAGTCGA
TCCAACAGGAAGTGATGCAACACGACGGTGATGAAGCCGTCAATCCTGGTGCTTTCTGGTTGTCAAACGTCCACG
AGATGTTGTCGTTTGTCTTCCTCGCGGAAGACTGGTACGAGACTCAGAAGACGGACAACTACGAGTACGACCGGC
TCTTGGAGATCGTCAAACACGACCTGGAAAGCCTCGAATTCAACATTTACCACACGTGGATGAAGGTGCTGAAGA
AGAAGCTGCACAAGATGATTATCCCGGCAATCATCGAATCGCAGTCGCTTCCGGGCTTCATCACCAACGAGAGCA
ACCGCTTCCTCGGCAAGCTCTTGCAGTCCAACACGGCACCGGCCTATAGCATGGACAATCTGCTCAGTCTCCTCA
ACAGCGTTTTCCGAGCGATGAAGGCCTTCTATCTCGAAGACTCCATCATCACACAGACTGTGACGGAACTCCTGA
GGCTAGTTGGCGTGACGGCATTCAACGACTTGCTGATGCGTCGGAACTTCCTTTCGTGGAAGCGAGGTCTTCAGA
TCAACTACAACATCACTCGTATCGAGGAGTGGTGCAAGAGCCACGACATGCCTGAAGGGACGCTGCAGCTGGAGC
ATCTGATGCAGGCGACGAAGCTTCTCCAGCTGAAGAAGGCGACGCTCAACGACATTGAAATCATCCAGGACATCT
GCTGGATGCTATCGCCGAACCAGATCCAAAAGCTGCTGAACCAGTACCTGGTGGCAGACTACGAGCAGCCCATAA
ACGGAGAGATTATGAAGGCCGTCGCGTCGCGGGTCACGGAGAAGAGCGACGTACTGCTTCTTCAAGCGGTAGACA
TGGAGGACAGCGGCCCTTATGAGATTGCCGAGCCGCGGTCCATCACGGCGCTGGAGACGTATACACCTTCGTGTA
AGTGAAGATGCTGCGGTCATGGCCAGGGACACGAGACTGACAGCAGGATCGCAGGGCTGCAAACGCCACGGCTGA
AGCGCTTGGCCGAGATCGTGTCGGCACAGGCCATTGCGCAGCAAGAGAAGCTCGAGTACGCCGACGGCCCGGACG
GTAACGGGACTCTGGAAGAGGCCGACGAGACGAGTGCCGAAGGAGCGACGGCCGTTGTCGAGCAGTAAGTTCGAT
ACGGATGTTTCGGCTGCGATCAGGGCGAGCAATCGTCCGTCAGTCGCACGTATCAAGGCGCGACCTGAGCCCGAT
GGCCTCCCTTGTTTTTGCGAGTTCGATGCAGCAGCGGGCGTCACGACCAAGAGCGGACTTTGAGGATGCAGTAAT
TTGCTATGATGTATGTACGACCAGTATATAAACCATAGAGGGACACTACTAGGTAAAAACAATTAGACGTGCTAT
ACAGCTTGAAATCCGGGGTCATTCATCAATCATCCCATGAGTATTCGGACCTCTGGGTGCGAGCGATGAACGGGG
TCTCCCACCGCGTGGGCGGACAATAGCCCAGCTACTTCGAGTCAACATTGACGACGTTGATGGCGAGAGTTCCGG
GAGAAGACTAGAAGTGACTTTTCGCTTCTAGTACATTATCCTTGCTTGTGAAGGTAACGTTCACGATGGTAAGAG
CAAGCAGAAGGCAGAGAATGTCAGAGTTGCAGATCTTAGGAGGCAACCGGGAGACAGTCTAGACCTGTGTACATA
TGTATGTACATACATAGTATGTATTATTACAGTGGCTTGCCCCATTTCGGATCCGCTTGCAGGCCGGGGTCCGGG
ATCTGGGGTCCGGGGTTGCGGGACCCAAGGTCCGGGGAATGGCGCCACTAACTGCCACATCTACGGGATGGTAGT
TTACCCATTCCATTACCCCGCACCAGCATCACCTGACGCCGCCACTTGCGTACCTACCTACCTTATCTACCTAGG
CCGGGCTGTATCAGGGTTGCGAACCTCCAGCATCGTCTACTTCGAGGCTCCTAGCGGCTACAGCAGACCATCAGG
TACACACAGGCCTCATCATGGATGGCGTCATGTACCGCCAACGTTGGGTCGAAGGCCCTTTTGGGATGGCCCTTC
CACAGGATGGCCCTTGAGATGGCCCTGGGAATGGCCCCCGCGTGGCGCCACGAATCATACTAAACTCTCGCCCCG
AGGTGGTAAGGCGAGAGTGAAGGGGAAGCAACGACGCCCCAGGTCGTACCTACCCTCCTGTTCCCTCTGCAACTC
CCCCTCATTTGCTTGCATCCTTTTCTTCTGCCTACATCCTCTATCCTCTCACCTCGGAGCATCTCCACGAAAATC
AAGACATCAGAACACACCAGATATCAGTGGGTTGAGCCAGCCAGACACACATACAAGACAAACATACGAAGTACA
CCTTCCTTCACTAACTCGCTCGTCTACCTACCTACCTACATATCTATCTACATACTCACCGAGTCACCGCCTTGA
GCCATCATCGCTGACCGCTCGCATCCATCTCAGGCTTTCACCATGCCTCCTCACCGTATCCCTAAGCTCCCCCGC
GCCAGACCGTCCGAGATGCTCTGCATGGGCGCCGCCGGCGTCGGCGTTCTCACTCCGCTCTACCTCGTCATGCCC
GGCGCCGAGGAGCGCCTGGCCCGCCAGACGACAAAGTGGGCTCCTCGCTGGGAGCGCAACATCTCCTTCTTCGCT
CCGCCCGTCGAGCGCACCGTTCGCCGGCTGGAGGCCCCCGTTGCCCGTGCTGTTCGGCGGGTAGAGGGTCGGTTA
CCGCTCGAGAGCATGGCCAAGCGCGTCGACGCTGGCATCCGTCGCGTTTGGCCGCCAAGACCGGCTGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail