Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00068
Gene name
Locationscaffold_01:174345..176160
Strand-
Gene length (bp)1815
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 57 76 19
3 140 162 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 5.98 1.64 10.31
Alive In ants, during behavior modification 10.86 3.56 18.17
Dead In ants, recently dead 7.00 1.95 12.05

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.050101 no
Alive Dead 0.099022 no
Dead Fungus 0.673809 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00068
MNATADASFGPRLSDRFDTLKFEQAVFSIGPSAVLSFASPLGIAILARRQPTFRADALLWSKMTFFFYLAFGWLN
WRCGLYPHRLYALESRWLFPDVVAMGSLLYAEHRYSHSPSTMISLYLSVTILLETASIRSLFLRGGLFAFAIVSV
AALAVKLLLLALEEIPKLELSAPATGYTAFLGVDDLPSLDHKLDSHRLVSSLKQEWKSVEKPVEHSLAYATFACL
QGHRLGWVRTLEKCVWTTPGAWLGALLPLRLEVYLGIAVSKCHYMHHTFRLITSLRGGLVALIFAKASLRVKHSN
SPSDLGQLSSLLCLESNLADQLTPILVITPVVF*
Coding >Ophcf2|00068
ATGAACGCCACTGCAGACGCCTCCTTCGGCCCACGGCTGTCGGACCGCTTCGACACCCTGAAATTCGAGCAAGCC
GTCTTCTCTATCGGTCCATCTGCTGTCCTGTCATTTGCCTCACCGCTCGGCATTGCGATCCTAGCCCGAAGACAG
CCGACTTTCCGGGCCGATGCCCTGCTCTGGTCCAAGATGACATTCTTCTTCTATTTGGCCTTCGGCTGGCTGAAC
TGGCGTTGTGGATTGTATCCTCACCGGCTATACGCACTCGAATCACGTTGGCTGTTTCCCGATGTCGTGGCCATG
GGATCGCTGCTTTATGCTGAGCATCGTTACTCTCACTCGCCCTCCACAATGATTAGCCTGTACTTATCCGTCACG
ATTCTGCTTGAAACTGCAAGCATTCGCTCCCTCTTTCTTCGCGGCGGTCTGTTTGCCTTTGCCATCGTCAGCGTT
GCTGCTCTTGCTGTCAAGCTCCTGCTTCTCGCACTCGAAGAGATCCCTAAGCTGGAGCTCTCTGCACCCGCAACG
GGCTATACTGCCTTTCTTGGAGTCGATGACTTGCCCAGCCTCGATCATAAGCTTGACTCTCACCGGCTTGTCTCT
AGCTTGAAGCAGGAATGGAAATCGGTTGAGAAACCTGTCGAGCACTCTCTGGCTTATGCCACTTTTGCCTGCCTT
CAAGGCCACCGTCTGGGCTGGGTCCGGACTCTGGAGAAATGCGTCTGGACGACTCCCGGGGCGTGGTTGGGGGCC
TTGTTGCCGCTACGGCTTGAGGTATATCTTGGGATAGCGGTCTCGAAATGTCACTACATGCATCACACATTCCGT
CTCATCACCTCCTTACGAGGCGGTCTTGTGGCGCTCATCTTTGCCAAAGCCTCCCTGCGTGTTAAGCATAGCAAC
AGCCCGAGTGACTTAGGGCAGCTCTCGTCTCTTCTCTGTCTTGAATCCAATCTCGCCGATCAGTTGACTCCCATC
CTCGTCATTACCCCGGTCGTCTTCTGA
Transcript >Ophcf2|00068
ATGAACGCCACTGCAGACGCCTCCTTCGGCCCACGGCTGTCGGACCGCTTCGACACCCTGAAATTCGAGCAAGCC
GTCTTCTCTATCGGTCCATCTGCTGTCCTGTCATTTGCCTCACCGCTCGGCATTGCGATCCTAGCCCGAAGACAG
CCGACTTTCCGGGCCGATGCCCTGCTCTGGTCCAAGATGACATTCTTCTTCTATTTGGCCTTCGGCTGGCTGAAC
TGGCGTTGTGGATTGTATCCTCACCGGCTATACGCACTCGAATCACGTTGGCTGTTTCCCGATGTCGTGGCCATG
GGATCGCTGCTTTATGCTGAGCATCGTTACTCTCACTCGCCCTCCACAATGATTAGCCTGTACTTATCCGTCACG
ATTCTGCTTGAAACTGCAAGCATTCGCTCCCTCTTTCTTCGCGGCGGTCTGTTTGCCTTTGCCATCGTCAGCGTT
GCTGCTCTTGCTGTCAAGCTCCTGCTTCTCGCACTCGAAGAGATCCCTAAGCTGGAGCTCTCTGCACCCGCAACG
GGCTATACTGCCTTTCTTGGAGTCGATGACTTGCCCAGCCTCGATCATAAGCTTGACTCTCACCGGCTTGTCTCT
AGCTTGAAGCAGGAATGGAAATCGGTTGAGAAACCTGTCGAGCACTCTCTGGCTTATGCCACTTTTGCCTGCCTT
CAAGGCCACCGTCTGGGCTGGGTCCGGACTCTGGAGAAATGCGTCTGGACGACTCCCGGGGCGTGGTTGGGGGCC
TTGTTGCCGCTACGGCTTGAGGTATATCTTGGGATAGCGGTCTCGAAATGTCACTACATGCATCACACATTCCGT
CTCATCACCTCCTTACGAGGCGGTCTTGTGGCGCTCATCTTTGCCAAAGCCTCCCTGCGTGTTAAGCATAGCAAC
AGCCCGAGTGACTTAGGGCAGCTCTCGTCTCTTCTCTGTCTTGAATCCAATCTCGCCGATCAGTTGACTCCCATC
CTCGTCATTACCCCGGTCGTCTTCTGA
Gene >Ophcf2|00068
ATGAACGCCACTGCAGACGCCTCCTTCGGCCCACGGCTGTCGGACCGCTTCGACACCCTGAAATTCGAGCAAGCC
GTCTTCTCTATCGGTCCATCTGCTGTCCTGTCATTTGCCTCACCGCTCGGCATTGCGATCCTAGCCCGAAGACAG
CCGACTTTCCGGGCCGATGCCCTGCTCTGGTCCAAGATGGTGAGCGGCTTCGTCTGCTGCTTCTCGACGTTGTGC
TGACCCTGGACAGACATTCTTCTTCTATTTGGCCTTCGGCTGGCTGAACTGGCGTTGTGGATTGTATCCTCACCG
GCTATACGCACTCGAATCACGTTGGCTGTTTCCCGATGTCGTGGCCATGGGATCGCTGCTTTATGCTGAGCATCG
TTACTCTCACTCGCCCTCCACAATGATTAGCCTGTACTTATCCGTCACGATTCTGCTTGAAACTGCAAGCATTCG
CTCCCTCTTTCTTCGCGGCGGTCTGTTTGCCTTTGCCATCGTCAGCGTTGCTGCTCTTGCTGTCAAGCTCCTGCT
TCTCGCACTCGAAGAGATCCCTAAGCTGGAGCTCTCTGCACCCGCAACGTTCAGAGAGACTTCGAGCGTGATTTG
GAATCGCTCCGTCTTCTAGTGGCTGAAATCGACCCTCTTCAGGGGCTATACTGCCTTTCTTGGAGTCGATGACTT
GCCCAGCCTCGATCATAAGCTTGACTCTCACCGGCTTGTCTCTAGCTTGAAGCAGGAATGGAAATCGGGTAGGTT
GGCAGCAGCGTGCTTATCAGTCTTCATCGTCAATCGTGCTGATTCTTAAGCCAGTTGAGAAACCTGTCGAGCACT
CTCTGGCTTATGCCACTTTTGCCTGCCTTCAAGGCCACCGTCTGGGCTGGGGTAATTCCTAGGCTCTGCTTCACA
GGCTTCACCTTTGCTCAGCCCTTTCTGCTTAATACAGTCGTCCAATTCCTCGGGAGCACGAGTCCGGACTCTGGA
GAAATGCGTCTGGACGACTCCCGGGGCGTGGTTGGGGGCCTTGTTGCCGCTACGGCTTGAGGTATATCTTGGGAT
AGCGGTATGTCAAGTGTTGAGCGGACATCATCGTCCTCACCCGCTTATCCGTAGCATCCGCAGGTCTCGAAATGT
CACTACATGCATCACACATTCCGTCTCATCACCTCCTTACGAGGCGGTCTTGTGGCGCTCATCTTTGCCAAAGCC
GTGGGCCTAGAGGCGACTACGGCTATGGACACTGCTGCTTTGACCCTAATGAGCACCGACTTGAACGGAATCTCT
AGCGGACTTTAGGATGTTCACGATTTGTGGGCGAGCTTCATCGAGCTAGGTCTCGGTGTCTTCCTGCTTCAACGA
CAAGTCGGAGCGGCCTGCTTCCTGTTACTAGTCCCTGCGGTTCGTAAGTCCTAACTTGCCTCTCCCGGCATCGCG
GCTCTAGGCTTTCTTTACCCCTGACGACGGTAACGGTGTGTAGTGTTAAGCATAGCAACAGCCCGAGTGACTTAG
GGCGTAAGTCCCGCTAAAGCGTTGTGGAATTCCAATGTATAGAAGCGAGTCTCAACAACCTCGTCGGCTCTCGGC
CAAATCAAGGGCATTAAGATGATGGGCATCGAAGACCGCATCTCCCGCCCTATCTAGTCTCTCTGTGTTTACAAA
CTTAATTCGTCTAAGAGCTCTCGTCTCTTCTCTGTCTTGAATGTGAGATAGGTGCTTGTTGTTGCCTCGACTAAC
GGACTCTTGGTCCGGGTTGCTAACGTCCCCACAGCCAATCTCGCCGATCAGTTGACTCCCATCCTCGTCATTACC
CCGGTCGTCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail