Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00063
Gene name
Locationscaffold_01:165406..166626
Strand+
Gene length (bp)1220
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06516 NUP Purine nucleoside permease (NUP) 8.4E-127 1 320

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5839 0.2715 0.2907 0.2477 0.1311 0.0295 0.0205 0.2576 0.1423 0.0423

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4557
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5695
Ophiocordyceps australis map64 (Brazil) OphauB2|5491
Ophiocordyceps camponoti-floridani Ophcf2|00063 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|625
Ophiocordyceps kimflemingae Ophio5|4074
Ophiocordyceps subramaniannii Hirsu2|9538

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00063
MIISMFAPEADAWHTRFHESSLGNLSAIAIAPPGLSMLFPQILCTQDGLICQATLGEGEINAAASMTALVLCPDL
NLKHTYFLLAGIAGVNPHQATLGSVALARFAVQPALQTEIDPRSLPENFSTGYMSFGRNRPLEYPTILYGTEVFE
LNVALRDAASLLASRATLADDDASRRYRALYRDNKSYANATLPPSVVKCDCTTSDVYYSGTILSQVFEDTTRLWT
NGSAVYCMTAQEDNAVLEVLLRAAVHGLVDYSRVMVMRTASDFDRPPPGISDLHHLTRIDQNGFVIAIENLYRAG
MEIVRGILAGWHSTYSRGIPAPNYLGDVFGSLGGTPDFGPGSRFDGKAVKPAGGRRPGRRVVSRVRVPAS*
Coding >Ophcf2|00063
ATGATCATCTCAATGTTCGCCCCAGAAGCAGACGCCTGGCACACCCGCTTCCACGAATCTTCCCTCGGCAACCTC
TCCGCCATAGCCATAGCTCCCCCAGGCCTCTCAATGCTCTTCCCCCAAATCCTCTGCACTCAAGACGGCCTCATC
TGCCAAGCAACACTCGGCGAAGGCGAGATCAACGCCGCCGCCTCGATGACCGCCCTCGTCCTATGCCCAGACCTC
AATCTCAAACACACCTACTTCCTCCTCGCAGGCATCGCAGGCGTAAACCCCCATCAAGCAACCCTGGGCAGCGTC
GCCCTCGCCCGCTTCGCAGTCCAACCAGCCCTCCAGACAGAAATCGACCCTCGCTCCCTCCCGGAAAACTTCTCA
ACAGGATACATGTCATTCGGCCGCAACCGCCCCCTCGAATATCCCACCATCCTCTACGGCACCGAAGTCTTTGAG
CTCAACGTCGCCCTACGAGACGCAGCCTCCCTCCTCGCCTCCCGCGCCACCCTCGCTGACGACGACGCCTCCCGA
CGATACCGCGCCCTCTACCGCGATAACAAATCCTACGCCAACGCCACTCTTCCCCCCTCGGTCGTGAAGTGCGAC
TGCACCACCAGCGACGTCTACTACTCCGGCACCATACTCTCCCAAGTCTTTGAGGACACGACGCGTCTGTGGACA
AATGGCTCGGCCGTCTACTGCATGACCGCCCAGGAAGACAACGCCGTGCTCGAAGTCCTACTCCGCGCCGCCGTT
CACGGCCTGGTCGACTATTCCCGCGTCATGGTGATGCGAACGGCGTCCGACTTCGACCGGCCCCCTCCCGGGATC
TCAGACCTCCACCACCTAACCCGCATCGACCAAAACGGCTTCGTCATCGCAATCGAAAACCTCTACCGTGCCGGC
ATGGAGATTGTAAGAGGGATTCTCGCTGGCTGGCACTCCACCTATAGCCGCGGCATCCCCGCCCCCAATTACCTC
GGCGACGTCTTCGGTTCCCTAGGCGGCACGCCCGATTTCGGCCCGGGAAGTAGGTTTGATGGAAAGGCCGTCAAG
CCTGCTGGTGGGAGGAGGCCGGGTCGCAGGGTTGTGAGTCGGGTTCGGGTGCCTGCCTCGTGA
Transcript >Ophcf2|00063
ATGATCATCTCAATGTTCGCCCCAGAAGCAGACGCCTGGCACACCCGCTTCCACGAATCTTCCCTCGGCAACCTC
TCCGCCATAGCCATAGCTCCCCCAGGCCTCTCAATGCTCTTCCCCCAAATCCTCTGCACTCAAGACGGCCTCATC
TGCCAAGCAACACTCGGCGAAGGCGAGATCAACGCCGCCGCCTCGATGACCGCCCTCGTCCTATGCCCAGACCTC
AATCTCAAACACACCTACTTCCTCCTCGCAGGCATCGCAGGCGTAAACCCCCATCAAGCAACCCTGGGCAGCGTC
GCCCTCGCCCGCTTCGCAGTCCAACCAGCCCTCCAGACAGAAATCGACCCTCGCTCCCTCCCGGAAAACTTCTCA
ACAGGATACATGTCATTCGGCCGCAACCGCCCCCTCGAATATCCCACCATCCTCTACGGCACCGAAGTCTTTGAG
CTCAACGTCGCCCTACGAGACGCAGCCTCCCTCCTCGCCTCCCGCGCCACCCTCGCTGACGACGACGCCTCCCGA
CGATACCGCGCCCTCTACCGCGATAACAAATCCTACGCCAACGCCACTCTTCCCCCCTCGGTCGTGAAGTGCGAC
TGCACCACCAGCGACGTCTACTACTCCGGCACCATACTCTCCCAAGTCTTTGAGGACACGACGCGTCTGTGGACA
AATGGCTCGGCCGTCTACTGCATGACCGCCCAGGAAGACAACGCCGTGCTCGAAGTCCTACTCCGCGCCGCCGTT
CACGGCCTGGTCGACTATTCCCGCGTCATGGTGATGCGAACGGCGTCCGACTTCGACCGGCCCCCTCCCGGGATC
TCAGACCTCCACCACCTAACCCGCATCGACCAAAACGGCTTCGTCATCGCAATCGAAAACCTCTACCGTGCCGGC
ATGGAGATTGTAAGAGGGATTCTCGCTGGCTGGCACTCCACCTATAGCCGCGGCATCCCCGCCCCCAATTACCTC
GGCGACGTCTTCGGTTCCCTAGGCGGCACGCCCGATTTCGGCCCGGGAAGTAGGTTTGATGGAAAGGCCGTCAAG
CCTGCTGGTGGGAGGAGGCCGGGTCGCAGGGTTGTGAGTCGGGTTCGGGTGCCTGCCTCGTGA
Gene >Ophcf2|00063
ATGATCATCTCAATGGCACGTCAGAACTCCCCTCCTTCCCTTCCCTCCCCGGCCCTTCTAACAAGCATCCAGTTC
GCCCCAGAAGCAGACGCCTGGCACACCCGCTTCCACGAATCTTCCCTCGGCAACCTCTCCGCCATAGCCATAGCT
CCCCCAGGCCTCTCAATGCTCTTCCCCCAAATCCTCTGCACTCAAGACGGCCTCATCTGCCAAGCAACACTCGGC
GAAGGCGAGATCAACGCCGCCGCCTCGATGACCGCCCTCGTCCTATGCCCAGACCTCAATCTCAAACACACCTAC
TTCCTCCTCGCAGGCATCGCAGGCGTAAACCCCCATCAAGCAACCCTGGGCAGCGTCGCCCTCGCCCGCTTCGCA
GTCCAACCAGCCCTCCAGACAGAAATCGACCCTCGCTCCCTCCCGGAAAACTTCTCAACAGGATACATGTCATTC
GGCCGCAACCGCCCCCTCGAATATCCCACCATCCTCTACGGCACCGAAGTCTTTGAGCTCAACGTCGCCCTACGA
GACGCAGCCTCCCTCCTCGCCTCCCGCGCCACCCTCGCTGACGACGACGCCTCCCGACGATACCGCGCCCTCTAC
CGCGATAACAAATCCTACGCCAACGCCACTCTTCCCCCCTCGGTCGTGAAGTGCGACTGCACCACCAGCGACGTC
TACTACTCCGGCACCATACTCTCCCAAGTCTTTGAGGACACGACGCGTCTGTGGACAAATGGCTCGGCCGTCTAC
TGCATGACCGCCCAGGAAGACAACGCCGTGCTCGAAGTCCTACTCCGCGCCGCCGTTCACGGCCTGGTCGACTAT
TCCCGCGTCATGGTGATGCGAACGGGTCGGTTCTACCCTCTTTACAAATTATCCCATCTCCTAACAAAAGAACAG
CGTCCGACTTCGACCGGCCCCCTCCCGGGATCTCAGACCTCCACCACCTAACCCGCATCGACCAAAACGGCTTCG
TCATCGCAATCGAAAACCTCTACCGTGCCGGCATGGAGATTGTAAGAGGGATTCTCGCTGGCTGGCACTCCACCT
ATAGCCGCGGCATCCCCGCCCCCAATTACCTCGGCGACGTCTTCGGTTCCCTAGGCGGCACGCCCGATTTCGGCC
CGGGAAGTAGGTTTGATGGAAAGGCCGTCAAGCCTGCTGGTGGGAGGAGGCCGGGTCGCAGGGTTGTGAGTCGGG
TTCGGGTGCCTGCCTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail