Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00062
Gene name
Locationscaffold_01:159447..163156
Strand-
Gene length (bp)3709
Transcript length (bp)3621
Coding sequence length (bp)3621
Protein length (aa) 1207

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 1.8E-41 854 1026
PF00122 E1-E2_ATPase E1-E2 ATPase 1.5E-32 215 420
PF13246 Cation_ATPase Cation transport ATPase (P-type) 4.1E-22 504 596
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 8.5E-14 440 784
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 4.0E-07 117 159
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 2.4E-04 756 817

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

Domain # Start End Length
1 140 162 22
2 177 199 22
3 294 316 22
4 345 367 22
5 387 409 22
6 843 865 22
7 969 991 22
8 1006 1025 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00062
MDPVSAPCPSASVHAGQPDLADDDPPPNNCFAFTPTQLHTLVKLRNLAALDAFGGLPGLAAGLRTDVLAGLNANE
AVQLGTLTFDEAVAAGREGRDPSIDNIQPRSVLVWSGSCRFADRRRIFGTNQLPRRRHKSFLKLLWVAFNDKLLI
LLTITAFISVAIGIYRSLSSEFGTSSIEWVDGCTVIVAIIVIVLASAFNDWQQNHRFEKLNERSNQRKVTVVRSA
KPQRIWAHHLLVGDILHIEAGDVLAVDGVLVQAAGLHVDESSISGESAPVRKTTPADHNASHAGLADPFILSGTI
VTCGVGRYLVTSVGAASSHGRTLMSLREDVEETPLQAKLGRLGKQLIAFGAVVGSFFFVILFIRYLANLKRTAAD
SPAKKAEAFFQIVTISITLVIIAVPEGLALNVTVALAFAAKRMLKDNNLVRLIRSCEIMGNVTSVCSDKTGTLTQ
NKMKVVVGRIGADSSFDDLEAGPGDGRSRRTHTSARLAAALSEEVKDLVKGSMALNSTAFESDDPAAAASGYLGS
STETALLVFCRDRLGMGPLREERANSPIVAMLPFESSRKWMAVLVRLPEEGRYRLLVKGAAEVVFEFCAYVVCDV
TDELAAERLSEDDRTGFRLTIQSYAEKTLRPVAIAYRDFDASEVFESEDDDPADVNLEWLASGLFLIGVFGIRDP
LRDNVEDSVRKCQAAGVFVRMVTGDNFLTATAVAAQSGIYTPGGVAMDGPTFRRLSPSQLDAVIPRLQVLARSSP
EDKLLLVSHLRAMKEIVAVTGDGTNDALALKAADVGLAMGMQGTEVAKEAASIILLDDNFASIVKALSWGRTVND
SVKKFCQFQFTINISASILTVSVLVGLPIFTVVQLLWINLIMDIFASLGLATDLPSPECLHRGPEPRNAPIISIT
MWKMILGQSIYQLAVVFTVHFAGWDIFNPDSEFEIEKLQTLVFNIYVWMQFFNQHNCRRVDNKLDIWYNVLRNPW
FIGVQLITLVGQFVIIFKGGEAFDTVPLTGAQWGWSLLFGLLTLPLGALLRQVPDRYVLKLFRLFHGVFMAVVRS
LRILRACLFGSGRRRRERHDGIEGGRPTANDDIEAAPTQAAGELSTGLGRSSVESQSQDESGKTCSSEGSEDRVD
LQALIDAARVGRVTGRDRLELHPETLKDDPILGRRSNVKLPPSQDPALQIIETGDGDGARGCEQAATTSRSDVEQ
RGRRRW*
Coding >Ophcf2|00062
ATGGATCCCGTATCCGCCCCGTGCCCCTCCGCCTCGGTCCACGCCGGCCAACCTGACCTAGCCGACGACGATCCT
CCGCCCAATAACTGCTTCGCCTTCACCCCGACCCAGCTGCACACCCTCGTCAAATTGCGCAATCTTGCCGCCCTC
GATGCCTTTGGCGGTCTGCCCGGCTTGGCTGCCGGTCTCCGCACCGATGTCCTGGCCGGCCTCAACGCCAACGAG
GCTGTCCAGCTGGGAACCCTGACCTTTGACGAGGCCGTCGCCGCTGGTCGTGAGGGCCGCGATCCCTCCATCGAT
AATATCCAGCCACGCTCCGTCCTCGTCTGGAGTGGCTCTTGTCGCTTTGCCGACCGTCGGCGTATCTTTGGCACC
AACCAGCTGCCGCGCCGACGTCACAAGTCGTTCCTCAAGCTCCTCTGGGTCGCCTTCAACGATAAGCTCCTCATT
CTTCTCACCATCACCGCCTTCATCTCCGTCGCCATCGGCATCTATCGCTCTCTCAGCTCAGAGTTCGGCACCTCA
AGCATCGAATGGGTCGATGGCTGCACCGTCATCGTCGCCATCATCGTCATCGTCCTGGCCAGCGCCTTCAACGAC
TGGCAGCAGAACCATAGGTTCGAGAAGCTCAACGAGCGCAGTAACCAGCGTAAAGTTACAGTCGTTCGCTCCGCC
AAGCCCCAGCGCATCTGGGCCCATCACCTCCTCGTCGGCGATATCCTCCATATCGAAGCCGGCGATGTCCTCGCC
GTCGACGGCGTCCTCGTCCAGGCCGCTGGCCTTCATGTCGATGAGTCGTCCATTTCGGGAGAGTCGGCCCCCGTC
CGCAAGACGACTCCCGCCGATCACAACGCCTCCCATGCCGGCCTCGCCGACCCCTTTATCCTCAGTGGCACCATC
GTCACCTGCGGCGTTGGCCGCTATCTCGTCACCTCGGTAGGCGCCGCCTCCAGCCACGGACGAACCCTCATGTCC
CTGCGCGAGGACGTCGAGGAGACGCCCCTACAGGCCAAACTCGGCCGCCTCGGCAAACAGCTCATTGCCTTCGGC
GCCGTCGTCGGCAGCTTCTTCTTTGTCATCCTCTTCATCCGCTATCTGGCCAACCTCAAACGTACGGCGGCCGAC
TCGCCCGCCAAAAAGGCAGAGGCCTTCTTCCAGATCGTCACAATCTCCATCACGCTCGTCATCATCGCCGTCCCC
GAGGGCCTGGCGCTCAATGTCACCGTCGCCCTGGCCTTTGCCGCCAAACGAATGCTCAAGGACAACAACCTCGTG
CGCCTCATCCGCTCGTGCGAGATCATGGGAAACGTCACCAGCGTCTGTTCCGATAAGACGGGCACCCTGACCCAG
AACAAGATGAAGGTTGTTGTGGGCCGCATCGGCGCCGACAGCAGCTTTGATGACCTCGAGGCCGGCCCCGGCGAC
GGCCGCTCACGCCGGACCCACACGTCGGCCCGGCTCGCCGCCGCCCTTTCGGAAGAGGTCAAGGATCTGGTCAAG
GGCAGCATGGCCCTCAACTCGACGGCCTTCGAGAGCGACGACCCGGCCGCCGCAGCCTCGGGCTACCTCGGCTCC
AGCACAGAGACGGCGCTCCTCGTCTTCTGCCGCGACCGTCTCGGCATGGGTCCGCTACGCGAGGAGAGGGCCAAC
AGTCCCATCGTCGCCATGCTACCCTTTGAGTCCTCCCGAAAGTGGATGGCTGTCTTGGTCAGGCTGCCCGAAGAG
GGCCGGTACCGGCTGCTGGTCAAGGGCGCGGCCGAGGTCGTCTTCGAGTTCTGCGCTTACGTCGTCTGCGACGTC
ACCGACGAGTTGGCCGCCGAGCGGCTATCGGAAGATGATAGGACCGGCTTCCGCCTTACCATCCAGAGCTACGCC
GAGAAGACGCTGCGACCGGTGGCCATTGCCTACCGCGACTTTGACGCGTCTGAGGTGTTCGAGAGCGAAGACGAC
GACCCGGCCGACGTCAATCTCGAGTGGCTGGCGTCGGGCCTCTTCCTCATCGGCGTCTTTGGCATCCGGGATCCT
CTGAGGGATAACGTGGAGGACTCTGTGCGCAAGTGCCAGGCGGCCGGCGTCTTCGTCCGCATGGTGACGGGCGAC
AACTTCCTCACCGCCACGGCCGTGGCCGCCCAATCGGGCATCTACACGCCCGGAGGCGTCGCCATGGACGGTCCC
ACGTTCCGCAGGCTCTCGCCCTCACAGCTCGACGCCGTGATTCCCCGGCTGCAGGTGCTGGCGCGGTCCAGCCCA
GAGGATAAGCTCCTTCTAGTGTCGCACCTCCGCGCCATGAAGGAGATTGTGGCCGTGACGGGCGACGGCACCAAC
GACGCGCTGGCTCTCAAGGCCGCCGATGTCGGTCTCGCCATGGGGATGCAGGGCACTGAAGTGGCCAAAGAGGCG
GCTTCCATTATTCTGCTGGACGACAACTTTGCGTCCATCGTCAAGGCACTGAGCTGGGGCCGGACCGTCAACGAC
TCGGTCAAGAAGTTTTGTCAGTTCCAATTCACCATCAACATCTCGGCCAGCATCCTCACCGTCTCGGTCCTCGTC
GGCCTGCCCATCTTCACCGTGGTGCAGCTGCTCTGGATCAACCTCATCATGGACATCTTCGCCTCCCTCGGTCTG
GCTACGGACCTGCCCTCGCCCGAGTGCCTCCATCGCGGGCCGGAGCCGCGCAACGCACCCATCATCAGCATCACC
ATGTGGAAGATGATACTCGGCCAGTCCATCTACCAGCTCGCCGTCGTCTTCACCGTCCACTTTGCCGGATGGGAC
ATCTTCAACCCGGACAGCGAGTTCGAGATTGAGAAGCTGCAGACGCTCGTCTTTAATATTTACGTGTGGATGCAG
TTCTTCAATCAGCACAACTGTCGGAGGGTCGACAACAAGCTCGACATCTGGTACAACGTGCTGCGCAATCCATGG
TTCATCGGCGTCCAGTTAATCACCCTCGTCGGCCAGTTCGTCATCATCTTTAAGGGGGGCGAGGCCTTTGACACG
GTGCCCCTGACGGGGGCTCAGTGGGGATGGAGTCTGCTGTTTGGCCTGCTCACGCTTCCGCTCGGCGCGCTTCTG
CGCCAGGTGCCCGATCGCTACGTTCTGAAGCTTTTCAGGCTGTTTCACGGCGTCTTCATGGCCGTCGTCCGATCG
CTACGCATTCTCAGAGCCTGTCTGTTCGGATCGGGCCGACGACGAAGAGAGCGGCATGACGGCATCGAGGGGGGT
CGTCCGACGGCCAATGACGACATCGAAGCAGCTCCAACACAGGCCGCGGGCGAACTATCCACGGGCTTGGGTCGC
TCGTCGGTGGAGAGCCAGAGCCAGGATGAGAGCGGCAAGACGTGCTCGTCAGAGGGGTCCGAGGACAGGGTGGAC
CTACAGGCGCTGATCGACGCCGCCCGAGTCGGCAGGGTCACGGGCCGGGATCGGCTGGAGCTGCACCCGGAGACG
CTCAAGGACGACCCGATACTGGGACGGCGGAGCAACGTCAAGCTGCCGCCGAGCCAGGATCCGGCGTTGCAGATC
ATCGAGACGGGCGACGGGGACGGCGCGAGGGGGTGCGAGCAGGCAGCAACAACGAGTCGGTCTGATGTCGAGCAG
CGAGGGCGGAGGCGGTGGTAG
Transcript >Ophcf2|00062
ATGGATCCCGTATCCGCCCCGTGCCCCTCCGCCTCGGTCCACGCCGGCCAACCTGACCTAGCCGACGACGATCCT
CCGCCCAATAACTGCTTCGCCTTCACCCCGACCCAGCTGCACACCCTCGTCAAATTGCGCAATCTTGCCGCCCTC
GATGCCTTTGGCGGTCTGCCCGGCTTGGCTGCCGGTCTCCGCACCGATGTCCTGGCCGGCCTCAACGCCAACGAG
GCTGTCCAGCTGGGAACCCTGACCTTTGACGAGGCCGTCGCCGCTGGTCGTGAGGGCCGCGATCCCTCCATCGAT
AATATCCAGCCACGCTCCGTCCTCGTCTGGAGTGGCTCTTGTCGCTTTGCCGACCGTCGGCGTATCTTTGGCACC
AACCAGCTGCCGCGCCGACGTCACAAGTCGTTCCTCAAGCTCCTCTGGGTCGCCTTCAACGATAAGCTCCTCATT
CTTCTCACCATCACCGCCTTCATCTCCGTCGCCATCGGCATCTATCGCTCTCTCAGCTCAGAGTTCGGCACCTCA
AGCATCGAATGGGTCGATGGCTGCACCGTCATCGTCGCCATCATCGTCATCGTCCTGGCCAGCGCCTTCAACGAC
TGGCAGCAGAACCATAGGTTCGAGAAGCTCAACGAGCGCAGTAACCAGCGTAAAGTTACAGTCGTTCGCTCCGCC
AAGCCCCAGCGCATCTGGGCCCATCACCTCCTCGTCGGCGATATCCTCCATATCGAAGCCGGCGATGTCCTCGCC
GTCGACGGCGTCCTCGTCCAGGCCGCTGGCCTTCATGTCGATGAGTCGTCCATTTCGGGAGAGTCGGCCCCCGTC
CGCAAGACGACTCCCGCCGATCACAACGCCTCCCATGCCGGCCTCGCCGACCCCTTTATCCTCAGTGGCACCATC
GTCACCTGCGGCGTTGGCCGCTATCTCGTCACCTCGGTAGGCGCCGCCTCCAGCCACGGACGAACCCTCATGTCC
CTGCGCGAGGACGTCGAGGAGACGCCCCTACAGGCCAAACTCGGCCGCCTCGGCAAACAGCTCATTGCCTTCGGC
GCCGTCGTCGGCAGCTTCTTCTTTGTCATCCTCTTCATCCGCTATCTGGCCAACCTCAAACGTACGGCGGCCGAC
TCGCCCGCCAAAAAGGCAGAGGCCTTCTTCCAGATCGTCACAATCTCCATCACGCTCGTCATCATCGCCGTCCCC
GAGGGCCTGGCGCTCAATGTCACCGTCGCCCTGGCCTTTGCCGCCAAACGAATGCTCAAGGACAACAACCTCGTG
CGCCTCATCCGCTCGTGCGAGATCATGGGAAACGTCACCAGCGTCTGTTCCGATAAGACGGGCACCCTGACCCAG
AACAAGATGAAGGTTGTTGTGGGCCGCATCGGCGCCGACAGCAGCTTTGATGACCTCGAGGCCGGCCCCGGCGAC
GGCCGCTCACGCCGGACCCACACGTCGGCCCGGCTCGCCGCCGCCCTTTCGGAAGAGGTCAAGGATCTGGTCAAG
GGCAGCATGGCCCTCAACTCGACGGCCTTCGAGAGCGACGACCCGGCCGCCGCAGCCTCGGGCTACCTCGGCTCC
AGCACAGAGACGGCGCTCCTCGTCTTCTGCCGCGACCGTCTCGGCATGGGTCCGCTACGCGAGGAGAGGGCCAAC
AGTCCCATCGTCGCCATGCTACCCTTTGAGTCCTCCCGAAAGTGGATGGCTGTCTTGGTCAGGCTGCCCGAAGAG
GGCCGGTACCGGCTGCTGGTCAAGGGCGCGGCCGAGGTCGTCTTCGAGTTCTGCGCTTACGTCGTCTGCGACGTC
ACCGACGAGTTGGCCGCCGAGCGGCTATCGGAAGATGATAGGACCGGCTTCCGCCTTACCATCCAGAGCTACGCC
GAGAAGACGCTGCGACCGGTGGCCATTGCCTACCGCGACTTTGACGCGTCTGAGGTGTTCGAGAGCGAAGACGAC
GACCCGGCCGACGTCAATCTCGAGTGGCTGGCGTCGGGCCTCTTCCTCATCGGCGTCTTTGGCATCCGGGATCCT
CTGAGGGATAACGTGGAGGACTCTGTGCGCAAGTGCCAGGCGGCCGGCGTCTTCGTCCGCATGGTGACGGGCGAC
AACTTCCTCACCGCCACGGCCGTGGCCGCCCAATCGGGCATCTACACGCCCGGAGGCGTCGCCATGGACGGTCCC
ACGTTCCGCAGGCTCTCGCCCTCACAGCTCGACGCCGTGATTCCCCGGCTGCAGGTGCTGGCGCGGTCCAGCCCA
GAGGATAAGCTCCTTCTAGTGTCGCACCTCCGCGCCATGAAGGAGATTGTGGCCGTGACGGGCGACGGCACCAAC
GACGCGCTGGCTCTCAAGGCCGCCGATGTCGGTCTCGCCATGGGGATGCAGGGCACTGAAGTGGCCAAAGAGGCG
GCTTCCATTATTCTGCTGGACGACAACTTTGCGTCCATCGTCAAGGCACTGAGCTGGGGCCGGACCGTCAACGAC
TCGGTCAAGAAGTTTTGTCAGTTCCAATTCACCATCAACATCTCGGCCAGCATCCTCACCGTCTCGGTCCTCGTC
GGCCTGCCCATCTTCACCGTGGTGCAGCTGCTCTGGATCAACCTCATCATGGACATCTTCGCCTCCCTCGGTCTG
GCTACGGACCTGCCCTCGCCCGAGTGCCTCCATCGCGGGCCGGAGCCGCGCAACGCACCCATCATCAGCATCACC
ATGTGGAAGATGATACTCGGCCAGTCCATCTACCAGCTCGCCGTCGTCTTCACCGTCCACTTTGCCGGATGGGAC
ATCTTCAACCCGGACAGCGAGTTCGAGATTGAGAAGCTGCAGACGCTCGTCTTTAATATTTACGTGTGGATGCAG
TTCTTCAATCAGCACAACTGTCGGAGGGTCGACAACAAGCTCGACATCTGGTACAACGTGCTGCGCAATCCATGG
TTCATCGGCGTCCAGTTAATCACCCTCGTCGGCCAGTTCGTCATCATCTTTAAGGGGGGCGAGGCCTTTGACACG
GTGCCCCTGACGGGGGCTCAGTGGGGATGGAGTCTGCTGTTTGGCCTGCTCACGCTTCCGCTCGGCGCGCTTCTG
CGCCAGGTGCCCGATCGCTACGTTCTGAAGCTTTTCAGGCTGTTTCACGGCGTCTTCATGGCCGTCGTCCGATCG
CTACGCATTCTCAGAGCCTGTCTGTTCGGATCGGGCCGACGACGAAGAGAGCGGCATGACGGCATCGAGGGGGGT
CGTCCGACGGCCAATGACGACATCGAAGCAGCTCCAACACAGGCCGCGGGCGAACTATCCACGGGCTTGGGTCGC
TCGTCGGTGGAGAGCCAGAGCCAGGATGAGAGCGGCAAGACGTGCTCGTCAGAGGGGTCCGAGGACAGGGTGGAC
CTACAGGCGCTGATCGACGCCGCCCGAGTCGGCAGGGTCACGGGCCGGGATCGGCTGGAGCTGCACCCGGAGACG
CTCAAGGACGACCCGATACTGGGACGGCGGAGCAACGTCAAGCTGCCGCCGAGCCAGGATCCGGCGTTGCAGATC
ATCGAGACGGGCGACGGGGACGGCGCGAGGGGGTGCGAGCAGGCAGCAACAACGAGTCGGTCTGATGTCGAGCAG
CGAGGGCGGAGGCGGTGGTAG
Gene >Ophcf2|00062
ATGGATCCCGTATCCGCCCCGTGCCCCTCCGCCTCGGTCCACGCCGGCCAACCTGACCTAGCCGACGACGATCCT
CCGCCCAATAACTGCTTCGCCTTCACCCCGACCCAGCTGCACACCCTCGTCAAATTGCGCAATCTTGCCGCCCTC
GATGCCTTTGGCGGTCTGCCCGGCTTGGCTGCCGGTCTCCGCACCGATGTCCTGGCCGGCCTCAACGCCAACGAG
GCTGTCCAGCTGGGAACCCTGACCTTTGACGAGGCCGTCGCCGCTGGTCGTGAGGGCCGCGATCCCTCCATCGAT
AATATCCAGCCACGCTCCGTCCTCGTCTGGAGTGGCTCTTGTCGCTTTGCCGACCGTCGGCGTATCTTTGGCACC
AACCAGCTGCCGCGCCGACGTCACAAGTCGTTCCTCAAGCTCCTCTGGGTCGCCTTCAACGATAAGCTCCTCATT
CTTCTCACCATCACCGCCTTCATCTCCGTCGCCATCGGCATCTATCGCTCTCTCAGCTCAGAGTTCGGCACCTCA
AGCATCGAATGGGTCGATGGCTGCACCGTCATCGTCGCCATCATCGTCATCGTCCTGGCCAGCGCCTTCAACGAC
TGGCAGCAGAACCATAGGTTCGAGAAGCTCAACGAGCGCAGTAACCAGCGTAAAGTTACAGTCGTTCGCTCCGCC
AAGCCCCAGCGCATCTGGGCCCATCACCTCCTCGTCGGCGATATCCTCCATATCGAAGCCGGCGATGTCCTCGCC
GTCGACGGCGTCCTCGTCCAGGCCGCTGGCCTTCATGTCGATGAGTCGTCCATTTCGGGAGAGTCGGCCCCCGTC
CGCAAGACGACTCCCGCCGATCACAACGCCTCCCATGCCGGCCTCGCCGACCCCTTTATCCTCAGTGGCACCATC
GTCACCTGCGGCGTTGGCCGCTATCTCGTCACCTCGGTAGGCGCCGCCTCCAGCCACGGACGAACCCTCATGTCC
CTGCGCGAGGACGTCGAGGAGACGCCCCTACAGGCCAAACTCGGCCGCCTCGGCAAACAGCTCATTGCCTTCGGC
GCCGTCGTCGGCAGCTTCTTCTTTGTCATCCTCTTCATCCGCTATCTGGCCAACCTCAAACGTACGGCGGCCGAC
TCGCCCGCCAAAAAGGCAGAGGCCTTCTTCCAGATCGTCACAATCTCCATCACGCTCGTCATCATCGCCGTCCCC
GAGGGCCTGGCGCTCAATGTCACCGTCGCCCTGGCCTTTGCCGCCAAACGAATGCTCAAGGACAACAACCTCGTG
CGCCTCATCCGCTCGTGCGAGATCATGGGAAACGTCACCAGCGTCTGTTCCGATAAGACGGGCACCCTGACCCAG
AACAAGATGAAGGTTGTTGTGGGCCGCATCGGCGCCGACAGCAGCTTTGATGACCTCGAGGCCGGCCCCGGCGAC
GGCCGCTCACGCCGGACCCACACGTCGGCCCGGCTCGCCGCCGCCCTTTCGGAAGAGGTCAAGGATCTGGTCAAG
GGCAGCATGGCCCTCAACTCGACGGCCTTCGAGAGCGACGACCCGGCCGCCGCAGCCTCGGGCTACCTCGGCTCC
AGCACAGAGACGGCGCTCCTCGTCTTCTGCCGCGACCGTCTCGGCATGGGTCCGCTACGCGAGGAGAGGGCCAAC
AGTCCCATCGTCGCCATGCTACCCTTTGAGTCCTCCCGAAAGTGGATGGCTGTCTTGGTCAGGCTGCCCGAAGAG
GGCCGGTACCGGCTGCTGGTCAAGGGCGCGGCCGAGGTCGTCTTCGAGTTCTGCGCTTACGTCGTCTGCGACGTC
ACCGACGAGTTGGCCGCCGAGCGGCTATCGGAAGATGATAGGACCGGCTTCCGCCTTACCATCCAGAGCTACGCC
GAGAAGACGCTGCGACCGGTGGCCATTGCCTACCGCGACTTTGACGCGTCTGAGGTGTTCGAGAGCGAAGACGAC
GACCCGGCCGACGTCAATCTCGAGTGGCTGGCGTCGGGCCTCTTCCTCATCGGCGTCTTTGGCATCCGGGATCCT
CTGAGGGATAACGTGGAGGACTCTGTGCGCAAGTGCCAGGCGGCCGGCGTCTTCGTCCGCATGGTGACGGGCGAC
AACTTCCTCACCGCCACGGCCGTGGCCGCCCAATCGGGCATCTACACGCCCGGAGGCGTCGCCATGGACGGTCCC
ACGTTCCGCAGGCTCTCGCCCTCACAGCTCGACGCCGTGATTCCCCGGCTGCAGGTGCTGGCGCGGTCCAGCCCA
GAGGATAAGCTCCTTCTAGTGTCGCACCTCCGCGCCATGAAGGAGATTGTGGCCGTGACGGGCGACGGCACCAAC
GACGCGCTGGCTCTCAAGGCCGCCGATGTCGGTCTCGCCATGGGGATGCAGGGCACTGAAGTGGCCAAAGAGGCG
GCTTCCATTATTCTGCTGGACGACAACTTTGCGTCCATCGTCAAGGCACTGAGCTGGGGCCGGACCGTCAACGAC
TCGGTCAAGAAGTTTTGTCAGGTGAGTCTGCGCCTGCTCGAAGAAGACGGGAAAGAGATGAACAACGACGGAGAG
ACGAGAGGTTTTGCGCGGATGCTGACAGCCTCAGTTCCAATTCACCATCAACATCTCGGCCAGCATCCTCACCGT
CTCGGTCCTCGTCGGCCTGCCCATCTTCACCGTGGTGCAGCTGCTCTGGATCAACCTCATCATGGACATCTTCGC
CTCCCTCGGTCTGGCTACGGACCTGCCCTCGCCCGAGTGCCTCCATCGCGGGCCGGAGCCGCGCAACGCACCCAT
CATCAGCATCACCATGTGGAAGATGATACTCGGCCAGTCCATCTACCAGCTCGCCGTCGTCTTCACCGTCCACTT
TGCCGGATGGGACATCTTCAACCCGGACAGCGAGTTCGAGATTGAGAAGCTGCAGACGCTCGTCTTTAATATTTA
CGTGTGGATGCAGTTCTTCAATCAGCACAACTGTCGGAGGGTCGACAACAAGCTCGACATCTGGTACAACGTGCT
GCGCAATCCATGGTTCATCGGCGTCCAGTTAATCACCCTCGTCGGCCAGTTCGTCATCATCTTTAAGGGGGGCGA
GGCCTTTGACACGGTGCCCCTGACGGGGGCTCAGTGGGGATGGAGTCTGCTGTTTGGCCTGCTCACGCTTCCGCT
CGGCGCGCTTCTGCGCCAGGTGCCCGATCGCTACGTTCTGAAGCTTTTCAGGCTGTTTCACGGCGTCTTCATGGC
CGTCGTCCGATCGCTACGCATTCTCAGAGCCTGTCTGTTCGGATCGGGCCGACGACGAAGAGAGCGGCATGACGG
CATCGAGGGGGGTCGTCCGACGGCCAATGACGACATCGAAGCAGCTCCAACACAGGCCGCGGGCGAACTATCCAC
GGGCTTGGGTCGCTCGTCGGTGGAGAGCCAGAGCCAGGATGAGAGCGGCAAGACGTGCTCGTCAGAGGGGTCCGA
GGACAGGGTGGACCTACAGGCGCTGATCGACGCCGCCCGAGTCGGCAGGGTCACGGGCCGGGATCGGCTGGAGCT
GCACCCGGAGACGCTCAAGGACGACCCGATACTGGGACGGCGGAGCAACGTCAAGCTGCCGCCGAGCCAGGATCC
GGCGTTGCAGATCATCGAGACGGGCGACGGGGACGGCGCGAGGGGGTGCGAGCAGGCAGCAACAACGAGTCGGTC
TGATGTCGAGCAGCGAGGGCGGAGGCGGTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail