Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00057
Gene name
Locationscaffold_01:147993..149068
Strand+
Gene length (bp)1075
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08588 DUF1769 Protein of unknown function (DUF1769) 5.4E-36 26 250

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6665 0.3998 0.0583 0.0826 0.12 0.0164 0.2574 0.1445 0.1173 0.0803

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4556
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|403
Ophiocordyceps australis map64 (Brazil) OphauB2|2473
Ophiocordyceps camponoti-floridani Ophcf2|00057 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|617
Ophiocordyceps kimflemingae Ophio5|2543
Ophiocordyceps subramaniannii Hirsu2|9531

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00057
MADQYVLRVTAGPSYDEASHIEVPVNRPGPVRIQSALADIELSVRIRNYHGLPRASPETSAYFSASPHDTNNDQY
SIAFRFTPVAPQDCPDQGISGLDLQFGNDFDRPIRDRLPPGFSAALSFVKWWVDPGLDGDPYADQPYLFGPALSS
FNHLHVGPGEYDEAKGGLWFDEGGDDQGRAMRAALGVPDTSKSRMKWALREEAKAGWQFRYGQTYGLDFFNPYLD
FENLSLRLPGFQLPVIKYWDGQGLRYVLRNKSTGDAYLVILFTLHLKTDVNDDGTLKGRDTKDAAHGPREQVNET
FPGRRPEAATQIQDVD*
Coding >Ophcf2|00057
ATGGCAGACCAATACGTGCTCCGCGTCACAGCCGGCCCCAGCTACGACGAAGCATCTCATATCGAGGTGCCCGTC
AACCGACCAGGGCCGGTGCGGATCCAGAGCGCCCTCGCCGACATTGAGCTCAGCGTCCGGATCCGCAACTACCAC
GGCTTGCCCCGTGCATCACCAGAGACGTCGGCCTACTTCTCGGCCAGTCCACATGATACCAACAACGACCAGTAC
AGCATTGCCTTTCGTTTCACCCCAGTCGCGCCTCAGGATTGTCCAGACCAGGGCATAAGCGGCTTAGACTTGCAG
TTTGGCAACGACTTTGACCGCCCCATACGCGACAGGCTGCCGCCTGGCTTCAGCGCCGCCCTCAGCTTCGTCAAG
TGGTGGGTGGACCCCGGCCTCGATGGCGACCCATACGCCGATCAGCCCTACCTCTTCGGCCCGGCCCTGAGTTCC
TTCAATCACCTGCACGTGGGACCCGGCGAGTATGACGAGGCCAAGGGCGGCCTGTGGTTCGACGAGGGCGGAGAC
GATCAAGGACGGGCGATGCGCGCCGCGCTCGGCGTGCCAGACACGAGCAAAAGCCGCATGAAGTGGGCGCTGCGC
GAGGAAGCCAAGGCTGGTTGGCAGTTTCGCTACGGCCAAACTTATGGACTCGATTTCTTCAACCCGTATCTCGAT
TTCGAGAACCTCTCTCTCCGACTGCCGGGCTTCCAGTTGCCCGTCATCAAGTACTGGGACGGCCAGGGCCTCAGA
TATGTTTTGAGAAACAAGAGCACCGGCGACGCCTATCTCGTCATTCTCTTCACCCTTCACCTCAAGACGGACGTC
AACGATGACGGTACACTCAAGGGACGTGACACGAAAGATGCGGCTCATGGGCCGCGCGAACAAGTCAACGAGACT
TTTCCAGGGCGAAGACCAGAGGCTGCAACGCAGATTCAAGACGTCGACTAA
Transcript >Ophcf2|00057
ATGGCAGACCAATACGTGCTCCGCGTCACAGCCGGCCCCAGCTACGACGAAGCATCTCATATCGAGGTGCCCGTC
AACCGACCAGGGCCGGTGCGGATCCAGAGCGCCCTCGCCGACATTGAGCTCAGCGTCCGGATCCGCAACTACCAC
GGCTTGCCCCGTGCATCACCAGAGACGTCGGCCTACTTCTCGGCCAGTCCACATGATACCAACAACGACCAGTAC
AGCATTGCCTTTCGTTTCACCCCAGTCGCGCCTCAGGATTGTCCAGACCAGGGCATAAGCGGCTTAGACTTGCAG
TTTGGCAACGACTTTGACCGCCCCATACGCGACAGGCTGCCGCCTGGCTTCAGCGCCGCCCTCAGCTTCGTCAAG
TGGTGGGTGGACCCCGGCCTCGATGGCGACCCATACGCCGATCAGCCCTACCTCTTCGGCCCGGCCCTGAGTTCC
TTCAATCACCTGCACGTGGGACCCGGCGAGTATGACGAGGCCAAGGGCGGCCTGTGGTTCGACGAGGGCGGAGAC
GATCAAGGACGGGCGATGCGCGCCGCGCTCGGCGTGCCAGACACGAGCAAAAGCCGCATGAAGTGGGCGCTGCGC
GAGGAAGCCAAGGCTGGTTGGCAGTTTCGCTACGGCCAAACTTATGGACTCGATTTCTTCAACCCGTATCTCGAT
TTCGAGAACCTCTCTCTCCGACTGCCGGGCTTCCAGTTGCCCGTCATCAAGTACTGGGACGGCCAGGGCCTCAGA
TATGTTTTGAGAAACAAGAGCACCGGCGACGCCTATCTCGTCATTCTCTTCACCCTTCACCTCAAGACGGACGTC
AACGATGACGGTACACTCAAGGGACGTGACACGAAAGATGCGGCTCATGGGCCGCGCGAACAAGTCAACGAGACT
TTTCCAGGGCGAAGACCAGAGGCTGCAACGCAGATTCAAGACGTCGACTAA
Gene >Ophcf2|00057
ATGGCAGACCAATACGTGCTCCGCGTCACAGCCGGCCCCAGCTACGACGAAGCATCTCATATCGAGGTGCCCGTC
AACCGACCAGGGCCGGTGCGGATCCAGAGCGCCCTCGCCGACATTGAGCTCAGCGTCCGGATCCGCAACTACCAC
GGCTTGCCCCGTGCATCACCAGAGACGTCGGCCTACTTCTCGGCCAGTCCACATGATACCAACAACGACCAGTAC
AGCATTGCCTTTCGTTTCACCCCAGTCGCGCCTCAGGATTGTCCAGACCAGGGCATAAGCGGCTTAGACTTGCAG
TTTGGCAACGACTTTGACCGCCCCATACGCGACAGGCTGCCGCCTGGCTTCAGCGCCGCCCTCAGCTTCGTCAAG
TGGTGGGTGGACCCCGGCCTCGATGGCGACCCATACGCCGATCAGCCCTACCTCTTCGGCCCGGCCCTGAGTTCC
TTCAATCACCTGCACGTGGGACCCGGCGAGTATGACGAGGCCAAGGGCGGCCTGTGGTTCGACGAGGGCGGAGAC
GATCAAGGACGGGCGATGCGCGCCGCGCTCGGCGTGCCAGACACGAGCAAAAGCCGCATGAAGTGGGCGCTGCGC
GAGGAAGCCAAGGCTGGTTGGCAGTTTCGCTACGGCCAAACTTATGGACTCGATTTCTTCAACCCGTATCTCGAT
TTCGAGAACCTCTCTCTCCGACTGCCGGGCTTCCAGTTGCCCGTCATCAAGTACTGGGACGGCCAGGGCCTCAGG
TGAGTCTTTTCCTTTTTCTTCAAATGCCCTTATGCATGACAGCGCGTGGAAAGACAAAAGGAAAGGGGGAAAAAA
GACTAAACATGCGGGCTCGCCCATTTGCAGGCGCTCACATCGACTTAGATATGTTTTGAGAAACAAGAGCACCGG
CGACGCCTATCTCGTCATTCTCTTCACCCTTCACCTCAAGACGGACGTCAACGATGACGGTACACTCAAGGGACG
TGACACGAAAGATGCGGCTCATGGGCCGCGCGAACAAGTCAACGAGACTTTTCCAGGGCGAAGACCAGAGGCTGC
AACGCAGATTCAAGACGTCGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail