Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00054
Gene name
Locationscaffold_01:138150..141804
Strand+
Gene length (bp)3654
Transcript length (bp)3513
Coding sequence length (bp)3513
Protein length (aa) 1171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18004 RPN2_C 26S proteasome regulatory subunit RPN2 C-terminal domain 3.7E-58 867 1037
PF01851 PC_rep Proteasome/cyclosome repeat 3.6E-05 522 553
PF01851 PC_rep Proteasome/cyclosome repeat 1.0E-04 595 625
PF01851 PC_rep Proteasome/cyclosome repeat 1.2E-08 732 766
PF13646 HEAT_2 HEAT repeats 3.7E-14 681 773

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.703 0.5469 0.0777 0.0609 0.1105 0.013 0.1132 0.1187 0.1642 0.0031

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4554
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7473
Ophiocordyceps australis map64 (Brazil) OphauB2|8039
Ophiocordyceps camponoti-floridani Ophcf2|00054 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|702
Ophiocordyceps kimflemingae Ophio5|2546
Ophiocordyceps subramaniannii Hirsu2|9526

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00054
MPGLVSATGVLAFLADEEPELKVFALQTLNDDIDTVWTEVAGALTQLEALYEDETFPERQLAALVLAKVYYHLQA
YNDSMAFALAAGDLFKLDSPGEFEETIISKCVDQYITVTAGRHAKPKASANADLPELTTTFSHASDGALMSPTTP
FSHTTLPPKSLLSRASLDNTILEATFQPVVKQARSGSLAQLPDKATEESLRTVVERLFESCLSQGRYRQVVGIAV
EAKNLDVLRRVIKRANDDEKRSKAKSHDGLQGPAEELMEYTLAMCMDVVQERGFRTEILRLILDLLNDIANPDYF
AIARCVVYLDSDEEASRMLRTLVSNGDRISLANAYQVAFDLYDNGTQEFLSRVLSSLPAGKRSGEGDDDKTAAGG
GGDEAKETDALLGSEPVSADDKAYRNIRSILEGSKTIRLNLEFLYRNNHTDLMILNKVRDSLEGRNSIFHTAVTF
CNALMNQGTTNDKFFRDNLEWLGKAVNWSKFTATAALGVIHRGNLSQSRKLLEPYLPRQGGLGSGSIFSQGGALY
AYGLIHANHGADALDYLKTQFAQAEQEVVQHGGALGLGIAGMATGDVEIFDKLKDTLFEDSALNGEAVGLSMGLI
MLGTGNVKALETMITYAHETTHEKIVRGAALGMALIMYGRQEGADVLIEGLLNDPDPTLRYGGILTVALAYCGSG
SNKAIRKLLHTAVSDVNDDVRRIAVMSLGFILFRKPGSVPRMVELLSESYNPHVRYGSAMALGISCAGTGLDEAI
DLLEPMMKDPTDFVRQGALISLAMIMVQQNEVMNPKVSSIRKTLKKVVGDRHEDAMTKFGAALALGIIDAGGRNC
TIGLQTQTGNLNMAGIVGMAVFTQYWYWFPFTHFLSLSFSPTAVIGLDHDLEMPDFKFHCAARQSLFDYPPEQEV
KAEEAPSLIATAILSTTAQAKRRAQKKERAQRRESMDLDQPPASAKSASADKMDVDDKKDEANDKKTSDDKEPPM
SAEAKKKPEKEKIGYDIENLSRVLPGQLKYISFPAGRYQPVKKPTGGPLLLDDTRPNEPKSLMEEKLKKATTERA
PVAGQQPPSSSSTSARPATTTRLSGRPLLEGLVDPSRAAAGDSALEQLLRAQRRSPFGLVDASRHQHQHQQHQQQ
TPASSSGAAAAAGVLTAVDEDGEGDEEAQVPREFDYFSDEEAGQD*
Coding >Ophcf2|00054
ATGCCTGGCTTGGTATCTGCCACCGGCGTTCTGGCCTTCCTTGCCGATGAGGAGCCGGAGCTCAAGGTCTTTGCC
CTGCAGACGCTCAACGACGACATCGACACGGTATGGACCGAGGTAGCCGGAGCTCTTACCCAGCTCGAGGCTCTG
TATGAAGATGAAACATTCCCTGAGCGCCAGCTCGCCGCCCTCGTTCTCGCAAAGGTCTACTATCATCTCCAAGCT
TACAATGACAGCATGGCCTTTGCCCTCGCAGCCGGCGATCTCTTCAAGCTTGACTCCCCAGGAGAGTTTGAGGAG
ACAATCATCTCCAAGTGTGTCGATCAGTACATTACCGTTACCGCCGGTCGTCACGCGAAACCAAAAGCCTCGGCC
AACGCCGACCTGCCCGAGCTGACGACGACCTTTTCCCACGCGTCCGACGGCGCCCTCATGTCGCCGACGACTCCA
TTCTCCCATACGACGTTGCCTCCAAAATCGTTGCTCTCCCGTGCCTCTCTCGACAATACCATCCTTGAAGCCACC
TTCCAACCCGTCGTCAAGCAGGCCCGCTCCGGCTCTTTGGCTCAGCTGCCTGACAAGGCCACTGAGGAGTCGTTG
CGCACGGTCGTCGAGCGTCTCTTTGAGAGCTGTCTATCGCAGGGTCGTTACCGTCAAGTCGTCGGTATCGCCGTC
GAAGCGAAAAATCTCGACGTGCTGCGACGCGTCATCAAGCGTGCAAACGATGACGAGAAGCGCTCCAAGGCCAAG
TCGCACGACGGGCTACAGGGTCCGGCCGAGGAGCTGATGGAGTATACGCTTGCCATGTGCATGGATGTTGTTCAA
GAGCGCGGCTTTCGCACCGAGATACTACGCCTTATCCTCGACCTGCTCAACGACATCGCCAACCCGGACTACTTC
GCCATTGCCCGCTGCGTCGTCTATCTCGACTCGGACGAAGAGGCGTCGCGCATGCTGCGCACTCTAGTGTCCAAC
GGTGACCGCATCTCGCTGGCAAATGCCTACCAGGTCGCCTTTGACCTGTACGATAACGGCACGCAAGAGTTCCTC
AGCCGCGTCTTGTCATCACTGCCGGCGGGCAAGCGATCAGGTGAGGGAGACGATGACAAGACGGCGGCCGGCGGT
GGCGGCGACGAGGCCAAGGAGACGGACGCCCTTCTCGGTAGCGAGCCGGTCTCGGCGGACGACAAGGCCTATCGC
AACATCCGCTCCATCCTCGAGGGCTCCAAGACGATCCGGCTCAACCTCGAGTTCCTCTACCGCAATAACCACACG
GACCTGATGATCCTCAACAAGGTGCGCGACAGCCTCGAGGGCCGCAACTCCATCTTCCACACGGCTGTCACCTTT
TGCAACGCCCTCATGAATCAGGGCACTACCAACGATAAGTTCTTCCGCGACAACCTCGAATGGCTGGGCAAGGCA
GTCAACTGGTCCAAGTTCACGGCCACGGCGGCGCTCGGCGTCATCCACCGAGGCAACCTGTCGCAGTCGCGCAAA
CTGCTAGAGCCCTACCTCCCGCGTCAGGGCGGTCTAGGCAGCGGCTCCATCTTCAGTCAGGGCGGCGCGCTGTAC
GCCTACGGCCTCATCCACGCCAACCACGGAGCCGACGCTCTCGACTACCTCAAGACGCAGTTTGCGCAGGCGGAG
CAGGAGGTGGTGCAGCACGGCGGCGCGCTGGGCCTCGGCATTGCCGGAATGGCGACGGGCGACGTGGAAATCTTC
GACAAGCTCAAGGACACGCTCTTTGAGGACTCGGCCCTCAACGGCGAGGCTGTCGGCCTCTCGATGGGTCTCATC
ATGTTGGGCACCGGCAACGTCAAGGCGCTCGAGACGATGATCACGTACGCGCACGAGACGACGCACGAGAAGATT
GTCCGCGGCGCGGCCCTCGGCATGGCCCTCATCATGTACGGCCGACAGGAGGGCGCCGACGTGCTGATCGAGGGC
CTTCTCAACGACCCGGACCCGACGCTCCGCTACGGCGGCATCCTCACCGTAGCCCTGGCCTACTGCGGCAGCGGA
AGCAACAAGGCGATCCGCAAGCTGCTGCACACGGCCGTCAGCGACGTCAACGACGATGTCCGCCGTATCGCCGTC
ATGAGCCTGGGCTTCATCCTCTTCCGCAAGCCCGGCAGCGTGCCGCGAATGGTTGAGCTGCTGTCCGAGTCGTAC
AACCCGCACGTCCGGTACGGATCGGCCATGGCGCTCGGCATCTCTTGCGCCGGCACCGGTCTGGACGAGGCCATC
GACCTGCTGGAGCCCATGATGAAGGACCCGACCGACTTTGTCCGCCAGGGCGCCCTCATCTCGCTCGCCATGATC
ATGGTGCAGCAGAACGAGGTCATGAACCCAAAGGTATCGTCGATCCGCAAGACGCTCAAGAAGGTGGTTGGCGAT
CGCCACGAAGACGCCATGACCAAGTTTGGCGCCGCTCTCGCCCTCGGAATCATCGACGCCGGTGGCCGCAACTGC
ACCATTGGCCTTCAGACGCAGACGGGTAACCTTAACATGGCGGGCATCGTGGGCATGGCAGTCTTCACCCAGTAC
TGGTACTGGTTCCCCTTTACCCACTTCCTCTCCCTGAGCTTCTCGCCCACGGCCGTCATCGGCCTCGATCACGAC
CTCGAGATGCCCGACTTCAAGTTTCACTGCGCCGCCCGCCAGAGCCTATTCGACTACCCGCCCGAGCAGGAGGTC
AAGGCCGAGGAGGCGCCCTCGCTCATCGCCACCGCCATTCTCTCCACCACGGCGCAGGCCAAGCGGAGGGCTCAG
AAGAAGGAGCGCGCCCAGCGTCGGGAGAGCATGGACTTGGATCAGCCGCCGGCTTCGGCTAAGAGCGCGTCCGCG
GATAAGATGGACGTGGACGACAAGAAGGACGAAGCCAACGACAAGAAGACGTCGGACGACAAGGAGCCGCCGATG
TCGGCCGAGGCCAAGAAGAAGCCGGAGAAGGAAAAGATTGGTTACGACATTGAGAATCTGAGCCGCGTCCTGCCG
GGCCAGCTCAAGTACATAAGCTTCCCGGCCGGCCGCTATCAGCCGGTCAAGAAGCCAACCGGCGGCCCCCTCCTC
CTCGACGACACCCGCCCCAACGAACCAAAGTCCCTGATGGAAGAGAAGCTCAAAAAGGCCACAACAGAACGCGCC
CCCGTCGCAGGCCAACAGCCTCCCTCTTCATCATCCACATCCGCCCGTCCCGCAACAACAACCCGTCTCAGCGGA
AGGCCCCTCCTCGAAGGCCTCGTCGACCCCTCCCGCGCCGCAGCCGGCGACTCCGCTCTTGAGCAGCTCCTCCGC
GCCCAGCGTCGATCTCCCTTTGGCCTCGTCGACGCTTCCCGTCACCAGCATCAGCATCAGCAGCACCAGCAGCAA
ACTCCGGCTTCTTCCTCCGGCGCTGCTGCGGCGGCCGGTGTTCTCACGGCCGTGGATGAGGATGGGGAAGGGGAT
GAGGAGGCGCAGGTCCCGAGGGAGTTTGATTACTTTTCTGACGAGGAAGCTGGTCAGGATTGA
Transcript >Ophcf2|00054
ATGCCTGGCTTGGTATCTGCCACCGGCGTTCTGGCCTTCCTTGCCGATGAGGAGCCGGAGCTCAAGGTCTTTGCC
CTGCAGACGCTCAACGACGACATCGACACGGTATGGACCGAGGTAGCCGGAGCTCTTACCCAGCTCGAGGCTCTG
TATGAAGATGAAACATTCCCTGAGCGCCAGCTCGCCGCCCTCGTTCTCGCAAAGGTCTACTATCATCTCCAAGCT
TACAATGACAGCATGGCCTTTGCCCTCGCAGCCGGCGATCTCTTCAAGCTTGACTCCCCAGGAGAGTTTGAGGAG
ACAATCATCTCCAAGTGTGTCGATCAGTACATTACCGTTACCGCCGGTCGTCACGCGAAACCAAAAGCCTCGGCC
AACGCCGACCTGCCCGAGCTGACGACGACCTTTTCCCACGCGTCCGACGGCGCCCTCATGTCGCCGACGACTCCA
TTCTCCCATACGACGTTGCCTCCAAAATCGTTGCTCTCCCGTGCCTCTCTCGACAATACCATCCTTGAAGCCACC
TTCCAACCCGTCGTCAAGCAGGCCCGCTCCGGCTCTTTGGCTCAGCTGCCTGACAAGGCCACTGAGGAGTCGTTG
CGCACGGTCGTCGAGCGTCTCTTTGAGAGCTGTCTATCGCAGGGTCGTTACCGTCAAGTCGTCGGTATCGCCGTC
GAAGCGAAAAATCTCGACGTGCTGCGACGCGTCATCAAGCGTGCAAACGATGACGAGAAGCGCTCCAAGGCCAAG
TCGCACGACGGGCTACAGGGTCCGGCCGAGGAGCTGATGGAGTATACGCTTGCCATGTGCATGGATGTTGTTCAA
GAGCGCGGCTTTCGCACCGAGATACTACGCCTTATCCTCGACCTGCTCAACGACATCGCCAACCCGGACTACTTC
GCCATTGCCCGCTGCGTCGTCTATCTCGACTCGGACGAAGAGGCGTCGCGCATGCTGCGCACTCTAGTGTCCAAC
GGTGACCGCATCTCGCTGGCAAATGCCTACCAGGTCGCCTTTGACCTGTACGATAACGGCACGCAAGAGTTCCTC
AGCCGCGTCTTGTCATCACTGCCGGCGGGCAAGCGATCAGGTGAGGGAGACGATGACAAGACGGCGGCCGGCGGT
GGCGGCGACGAGGCCAAGGAGACGGACGCCCTTCTCGGTAGCGAGCCGGTCTCGGCGGACGACAAGGCCTATCGC
AACATCCGCTCCATCCTCGAGGGCTCCAAGACGATCCGGCTCAACCTCGAGTTCCTCTACCGCAATAACCACACG
GACCTGATGATCCTCAACAAGGTGCGCGACAGCCTCGAGGGCCGCAACTCCATCTTCCACACGGCTGTCACCTTT
TGCAACGCCCTCATGAATCAGGGCACTACCAACGATAAGTTCTTCCGCGACAACCTCGAATGGCTGGGCAAGGCA
GTCAACTGGTCCAAGTTCACGGCCACGGCGGCGCTCGGCGTCATCCACCGAGGCAACCTGTCGCAGTCGCGCAAA
CTGCTAGAGCCCTACCTCCCGCGTCAGGGCGGTCTAGGCAGCGGCTCCATCTTCAGTCAGGGCGGCGCGCTGTAC
GCCTACGGCCTCATCCACGCCAACCACGGAGCCGACGCTCTCGACTACCTCAAGACGCAGTTTGCGCAGGCGGAG
CAGGAGGTGGTGCAGCACGGCGGCGCGCTGGGCCTCGGCATTGCCGGAATGGCGACGGGCGACGTGGAAATCTTC
GACAAGCTCAAGGACACGCTCTTTGAGGACTCGGCCCTCAACGGCGAGGCTGTCGGCCTCTCGATGGGTCTCATC
ATGTTGGGCACCGGCAACGTCAAGGCGCTCGAGACGATGATCACGTACGCGCACGAGACGACGCACGAGAAGATT
GTCCGCGGCGCGGCCCTCGGCATGGCCCTCATCATGTACGGCCGACAGGAGGGCGCCGACGTGCTGATCGAGGGC
CTTCTCAACGACCCGGACCCGACGCTCCGCTACGGCGGCATCCTCACCGTAGCCCTGGCCTACTGCGGCAGCGGA
AGCAACAAGGCGATCCGCAAGCTGCTGCACACGGCCGTCAGCGACGTCAACGACGATGTCCGCCGTATCGCCGTC
ATGAGCCTGGGCTTCATCCTCTTCCGCAAGCCCGGCAGCGTGCCGCGAATGGTTGAGCTGCTGTCCGAGTCGTAC
AACCCGCACGTCCGGTACGGATCGGCCATGGCGCTCGGCATCTCTTGCGCCGGCACCGGTCTGGACGAGGCCATC
GACCTGCTGGAGCCCATGATGAAGGACCCGACCGACTTTGTCCGCCAGGGCGCCCTCATCTCGCTCGCCATGATC
ATGGTGCAGCAGAACGAGGTCATGAACCCAAAGGTATCGTCGATCCGCAAGACGCTCAAGAAGGTGGTTGGCGAT
CGCCACGAAGACGCCATGACCAAGTTTGGCGCCGCTCTCGCCCTCGGAATCATCGACGCCGGTGGCCGCAACTGC
ACCATTGGCCTTCAGACGCAGACGGGTAACCTTAACATGGCGGGCATCGTGGGCATGGCAGTCTTCACCCAGTAC
TGGTACTGGTTCCCCTTTACCCACTTCCTCTCCCTGAGCTTCTCGCCCACGGCCGTCATCGGCCTCGATCACGAC
CTCGAGATGCCCGACTTCAAGTTTCACTGCGCCGCCCGCCAGAGCCTATTCGACTACCCGCCCGAGCAGGAGGTC
AAGGCCGAGGAGGCGCCCTCGCTCATCGCCACCGCCATTCTCTCCACCACGGCGCAGGCCAAGCGGAGGGCTCAG
AAGAAGGAGCGCGCCCAGCGTCGGGAGAGCATGGACTTGGATCAGCCGCCGGCTTCGGCTAAGAGCGCGTCCGCG
GATAAGATGGACGTGGACGACAAGAAGGACGAAGCCAACGACAAGAAGACGTCGGACGACAAGGAGCCGCCGATG
TCGGCCGAGGCCAAGAAGAAGCCGGAGAAGGAAAAGATTGGTTACGACATTGAGAATCTGAGCCGCGTCCTGCCG
GGCCAGCTCAAGTACATAAGCTTCCCGGCCGGCCGCTATCAGCCGGTCAAGAAGCCAACCGGCGGCCCCCTCCTC
CTCGACGACACCCGCCCCAACGAACCAAAGTCCCTGATGGAAGAGAAGCTCAAAAAGGCCACAACAGAACGCGCC
CCCGTCGCAGGCCAACAGCCTCCCTCTTCATCATCCACATCCGCCCGTCCCGCAACAACAACCCGTCTCAGCGGA
AGGCCCCTCCTCGAAGGCCTCGTCGACCCCTCCCGCGCCGCAGCCGGCGACTCCGCTCTTGAGCAGCTCCTCCGC
GCCCAGCGTCGATCTCCCTTTGGCCTCGTCGACGCTTCCCGTCACCAGCATCAGCATCAGCAGCACCAGCAGCAA
ACTCCGGCTTCTTCCTCCGGCGCTGCTGCGGCGGCCGGTGTTCTCACGGCCGTGGATGAGGATGGGGAAGGGGAT
GAGGAGGCGCAGGTCCCGAGGGAGTTTGATTACTTTTCTGACGAGGAAGCTGGTCAGGATTGA
Gene >Ophcf2|00054
ATGCCTGGCTTGGTATCTGCCACCGGCGTTCTGGCCTTCCTTGCCGATGAGGAGCCGGAGCTCAAGGTCTTTGCC
CTGCAGACGCTCAACGACGACATCGACACGGTATGGACCGAGGTAGCCGGAGCTCTTACCCAGCTGTGAGATAGA
AAAACTCTTTGCCTCGATCTCGTTTAGCGCTGACGCTTTCTTCACAGCGAGGCTCTGTATGAAGATGAAACATTC
CCTGAGCGCCAGCTCGCCGCCCTCGTTCTCGCAAAGGTCTACTATCATCTCCAAGCTTACAATGACAGCATGGCC
TTTGCCCTCGCAGCCGGCGATCTCTTCAAGCTTGACTCCCCAGGAGAGTTTGAGGAGACAATCATCTCCAAGTGT
GTCGATCAGTACATTACCGTTACCGCCGGTCGTCACGCGAAACCAAAAGCCTCGGCCAACGCCGACCTGCCCGAG
CTGACGACGACCTTTTCCCACGCGTCCGACGGCGCCCTCATGTCGCCGACGACTCCATTCTCCCATACGACGTTG
CCTCCAAAATCGTTGCTCTCCCGTGCCTCTCTCGACAATACCATCCTTGAAGCCACCTTCCAACCCGTCGTCAAG
CAGGCCCGCTCCGGCTCTTTGGCTCAGCTGCCTGACAAGGCCACTGAGGAGTCGTTGCGCACGGTCGTCGAGCGT
CTCTTTGAGAGCTGTCTATCGCAGGGTCGTTACCGTCAAGTCGTCGGTATCGCCGTCGAAGCGAAAAATCTCGAC
GTGCTGCGACGCGTCATCAAGCGTGCAAACGATGACGAGAAGCGCTCCAAGGCCAAGTCGCACGACGGGCTACAG
GGTCCGGCCGAGGAGCTGATGGAGTATACGCTTGCCATGTGCATGGATGTTGTTCAAGAGCGCGGCTTTCGCACC
GAGATACTACGCCTTATCCTCGACCTGCTCAACGACATCGCCAACCCGGACTACTTCGCCATTGCCCGCTGCGTC
GTCTATCTCGACTCGGACGAAGAGGCGTCGCGCATGCTGCGCACTCTAGTGTCCAACGGTGACCGCATCTCGCTG
GCAAATGCCTACCAGGTCGCCTTTGACCTGTACGATAACGGCACGCAAGAGTTCCTCAGCCGCGTCTTGTCATCA
CTGCCGGCGGGCAAGCGATCAGGTGAGGGAGACGATGACAAGACGGCGGCCGGCGGTGGCGGCGACGAGGCCAAG
GAGACGGACGCCCTTCTCGGTAGCGAGCCGGTCTCGGCGGACGACAAGGCCTATCGCAACATCCGCTCCATCCTC
GAGGGCTCCAAGACGATCCGGCTCAACCTCGAGTTCCTCTACCGCAATAACCACACGGACCTGATGATCCTCAAC
AAGGTGCGCGACAGCCTCGAGGGCCGCAACTCCATCTTCCACACGGCTGTCACCTTTTGCAACGCCCTCATGAAT
CAGGGCACTACCAACGATAAGTTCTTCCGCGACAACCTCGAATGGCTGGGCAAGGCAGTCAACTGGTCCAAGTTC
ACGGCCACGGCGGCGCTCGGCGTCATCCACCGAGGCAACCTGTCGCAGTCGCGCAAACTGCTAGAGCCCTACCTC
CCGCGTCAGGGCGGTCTAGGCAGCGGCTCCATCTTCAGTCAGGGCGGCGCGCTGTACGCCTACGGCCTCATCCAC
GCCAACCACGGAGCCGACGCTCTCGACTACCTCAAGACGCAGTTTGCGCAGGCGGAGCAGGAGGTGGTGCAGCAC
GGCGGCGCGCTGGGCCTCGGCATTGCCGGAATGGCGACGGGCGACGTGGAAATCTTCGACAAGCTCAAGGACACG
CTCTTTGAGGACTCGGCCCTCAACGGCGAGGCTGTCGGCCTCTCGATGGGTCTCATCATGTTGGGCACCGGCAAC
GTCAAGGCGCTCGAGACGATGATCACGTACGCGCACGAGACGACGCACGAGAAGATTGTCCGCGGCGCGGCCCTC
GGCATGGCCCTCATCATGTACGGCCGACAGGAGGGCGCCGACGTGCTGATCGAGGGCCTTCTCAACGACCCGGAC
CCGACGCTCCGCTACGGCGGCATCCTCACCGTAGCCCTGGCCTACTGCGGCAGCGGAAGCAACAAGGCGATCCGC
AAGCTGCTGCACACGGCCGTCAGCGACGTCAACGACGATGTCCGCCGTATCGCCGTCATGAGCCTGGGCTTCATC
CTCTTCCGCAAGCCCGGCAGCGTGCCGCGAATGGTTGAGCTGCTGTCCGAGTCGTACAACCCGCACGTCCGGTAC
GGATCGGCCATGGCGCTCGGCATCTCTTGCGCCGGCACCGGTCTGGACGAGGCCATCGACCTGCTGGAGCCCATG
ATGAAGGACCCGACCGACTTTGTCCGCCAGGGCGCCCTCATCTCGCTCGCCATGATCATGGTGCAGCAGAACGAG
GTCATGAACCCAAAGGTATCGTCGATCCGCAAGACGCTCAAGAAGGTGGTTGGCGATCGCCACGAAGACGCCATG
ACCAAGTTTGGCGCCGCTCTCGCCCTCGGAATCATCGACGCCGGTGGCCGCAACTGCACCATTGGCCTTCAGACG
CAGACGGGTAACCTTAACATGGCGGGCATCGTGGGCATGGCAGTCTTCACCCAGTACTGGTACTGGTTCCCCTTT
ACCCACTTCCTCTCCCTGAGCTTCTCGCCCACGGCCGTCATCGGCCTCGATCACGACCTCGAGATGCCCGACTTC
AAGTTTCACTGCGCCGCCCGCCAGAGCCTATTCGACTACCCGCCCGAGCAGGAGGTCAAGGCCGAGGAGGCGCCC
TCGCTCATCGCCACCGCCATTCTCTCCACCACGGCGCAGGCCAAGCGGAGGGCTCAGAAGAAGGAGCGCGCCCAG
CGTCGGGAGAGCATGGACTTGGATCAGCCGCCGGCTTCGGCTAAGAGCGCGTCCGCGGATAAGATGGACGTGGAC
GACAAGAAGGACGAAGCCAACGACAAGAAGACGTCGGACGACAAGGAGCCGCCGATGTCGGCCGAGGCCAAGAAG
AAGCCGGAGAAGGAAAAGATTGGTTACGACATTGAGAATCTGAGCCGCGTCCTGCCGGGCCAGCTCAAGTACATA
AGCTTCCCGGCCGGCCGCTATCAGCCGGTCAAGAAGGTGAGCCAGTCTCGTTGTCCTGATCCTCTAAGAACACCT
GAGAAAAGAAAGTAAAAGAAGAAACAACTGACCTCTTCGTGACAGCCAACCGGCGGCCCCCTCCTCCTCGACGAC
ACCCGCCCCAACGAACCAAAGTCCCTGATGGAAGAGAAGCTCAAAAAGGCCACAACAGAACGCGCCCCCGTCGCA
GGCCAACAGCCTCCCTCTTCATCATCCACATCCGCCCGTCCCGCAACAACAACCCGTCTCAGCGGAAGGCCCCTC
CTCGAAGGCCTCGTCGACCCCTCCCGCGCCGCAGCCGGCGACTCCGCTCTTGAGCAGCTCCTCCGCGCCCAGCGT
CGATCTCCCTTTGGCCTCGTCGACGCTTCCCGTCACCAGCATCAGCATCAGCAGCACCAGCAGCAAACTCCGGCT
TCTTCCTCCGGCGCTGCTGCGGCGGCCGGTGTTCTCACGGCCGTGGATGAGGATGGGGAAGGGGATGAGGAGGCG
CAGGTCCCGAGGGAGTTTGATTACTTTTCTGACGAGGAAGCTGGTCAGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail