Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00047
Gene name
Locationscaffold_01:123742..124311
Strand-
Gene length (bp)569
Transcript length (bp)498
Coding sequence length (bp)498
Protein length (aa) 166

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01284 MARVEL Membrane-associating domain 6.9E-14 21 138

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 49 68 19
3 81 103 22
4 118 140 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00047
MARGFAGLAGFAPIIYAALGVMLIVELGLTAFIVDRTDGFWSSPPSQFSFMLFATVWSILVLAYVALTPRFFARA
FHGLAAVILLILTTLFWFAGSIAMAALLGLPRCRGSFCTTTRTAQAATAFGFFIWAAFAVLAALDGMANLRGGAR
ADTTSSKQQQQPVAA*
Coding >Ophcf2|00047
ATGGCTCGTGGGTTCGCTGGGTTGGCTGGCTTTGCGCCGATTATTTACGCCGCGCTGGGCGTTATGCTCATCGTT
GAGCTGGGCCTCACAGCCTTCATCGTCGACCGAACCGATGGCTTCTGGTCTTCCCCCCCCTCGCAATTCAGCTTC
ATGCTCTTCGCAACAGTCTGGTCCATCCTGGTACTGGCCTACGTCGCGCTGACGCCACGCTTCTTCGCGCGCGCC
TTTCACGGTCTCGCGGCGGTAATACTCCTCATTTTGACGACGTTGTTCTGGTTCGCGGGATCGATTGCCATGGCA
GCGCTGCTGGGTTTGCCCAGGTGTAGGGGATCGTTTTGCACGACGACGAGGACGGCGCAGGCGGCTACGGCTTTT
GGCTTCTTCATCTGGGCTGCTTTCGCTGTGCTGGCTGCTCTGGATGGAATGGCGAATTTGAGGGGAGGGGCAAGG
GCGGATACGACGTCGAGTAAGCAGCAGCAGCAGCCTGTTGCTGCCTGA
Transcript >Ophcf2|00047
ATGGCTCGTGGGTTCGCTGGGTTGGCTGGCTTTGCGCCGATTATTTACGCCGCGCTGGGCGTTATGCTCATCGTT
GAGCTGGGCCTCACAGCCTTCATCGTCGACCGAACCGATGGCTTCTGGTCTTCCCCCCCCTCGCAATTCAGCTTC
ATGCTCTTCGCAACAGTCTGGTCCATCCTGGTACTGGCCTACGTCGCGCTGACGCCACGCTTCTTCGCGCGCGCC
TTTCACGGTCTCGCGGCGGTAATACTCCTCATTTTGACGACGTTGTTCTGGTTCGCGGGATCGATTGCCATGGCA
GCGCTGCTGGGTTTGCCCAGGTGTAGGGGATCGTTTTGCACGACGACGAGGACGGCGCAGGCGGCTACGGCTTTT
GGCTTCTTCATCTGGGCTGCTTTCGCTGTGCTGGCTGCTCTGGATGGAATGGCGAATTTGAGGGGAGGGGCAAGG
GCGGATACGACGTCGAGTAAGCAGCAGCAGCAGCCTGTTGCTGCCTGA
Gene >Ophcf2|00047
ATGGCTCGTGGGTTCGCTGGGTTGGCTGGCTTTGCGCCGATTATTTACGCCGCGCTGGGCGTTATGCTCATCGTT
GAGCTGGGCCTCACAGCCTTCAGTATGTGTTCTCATCGCTTCTTATCCAACGAGATGGGGAAGATGTGATATATG
GACTAACGCTTTACGCAGTCGTCGACCGAACCGATGGCTTCTGGTCTTCCCCCCCCTCGCAATTCAGCTTCATGC
TCTTCGCAACAGTCTGGTCCATCCTGGTACTGGCCTACGTCGCGCTGACGCCACGCTTCTTCGCGCGCGCCTTTC
ACGGTCTCGCGGCGGTAATACTCCTCATTTTGACGACGTTGTTCTGGTTCGCGGGATCGATTGCCATGGCAGCGC
TGCTGGGTTTGCCCAGGTGTAGGGGATCGTTTTGCACGACGACGAGGACGGCGCAGGCGGCTACGGCTTTTGGCT
TCTTCATCTGGGCTGCTTTCGCTGTGCTGGCTGCTCTGGATGGAATGGCGAATTTGAGGGGAGGGGCAAGGGCGG
ATACGACGTCGAGTAAGCAGCAGCAGCAGCCTGTTGCTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail