Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00043
Gene name
Locationscaffold_01:113943..115483
Strand+
Gene length (bp)1540
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12588 PSDC Phophatidylserine decarboxylase 2.3E-40 73 205
PF02666 PS_Dcarbxylase Phosphatidylserine decarboxylase 4.0E-38 239 437

GO

GO Term Description Terminal node
GO:0004609 phosphatidylserine decarboxylase activity Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0016831 carboxy-lyase activity No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0090407 organophosphate biosynthetic process No
GO:0016830 carbon-carbon lyase activity No
GO:0008610 lipid biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008150 biological_process No
GO:0016829 lyase activity No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2488 0.1495 0.5725 0.0661 0.2386 0.2178 0.3782 0.4762 0.4199 0.0376

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999739

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup309
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2710
Ophiocordyceps australis map64 (Brazil) OphauB2|5632
Ophiocordyceps australis map64 (Brazil) OphauB2|5656
Ophiocordyceps camponoti-floridani Ophcf2|00043 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6281
Ophiocordyceps kimflemingae Ophio5|2558
Ophiocordyceps subramaniannii Hirsu2|1125
Ophiocordyceps subramaniannii Hirsu2|3028
Ophiocordyceps subramaniannii Hirsu2|3864
Ophiocordyceps subramaniannii Hirsu2|989

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00043
MLKRLLFCLAGFVSLAHAGPENSPGTVAWDSLPRHLQGRRPGSWTEADVAAHSRFVRSVAAKADETPTLELIPPV
AALKRLIETQPRVYMHFVQMFEQIPWRRPYWLDSAGQEPEIRDYQHMLRVLNHIATTGPSLESSGIPMTNVMSYA
MGTSSGHAAFLDPDVNDAMARILAFWRRFLESPDSRNVLRSSSDSGWLGPTTLEALERLGNAPYNTSLKFCELYQ
CDSSDEHYGFNSWDDFFARRLRPGSRPVASPDDDNVIVSACEASPYNVVRDVKLRDTFWAKGQPYSILDMLGHDP
VADEFAGGTIYQAFLTPLSYHRWNAPVSGVVRRAMIVPGNYFSIPLSLDVRDRNETEIPSDAVVQSQAYFTSMST
RAVIVIEADNPAIGLMAFVAVGMTDVSSCEIGVREGQHVRKGQEIGTFHYGGSTHCLLFRSGLELDGLPQVDNVT
LTHVNNVPVSGRLAVVRGPAQKRRV*
Coding >Ophcf2|00043
ATGCTCAAACGTCTCCTCTTCTGCCTGGCTGGCTTCGTGTCTCTGGCCCATGCCGGCCCCGAGAACTCCCCTGGA
ACGGTGGCATGGGACTCCCTCCCGAGACACCTCCAGGGTCGCCGGCCCGGGTCTTGGACCGAGGCCGACGTCGCC
GCTCACTCGCGCTTCGTCCGCTCCGTGGCCGCAAAGGCCGATGAGACCCCGACGCTGGAGCTGATCCCGCCCGTC
GCGGCCCTCAAGCGACTGATCGAGACGCAGCCACGCGTCTATATGCACTTTGTCCAGATGTTTGAGCAGATCCCC
TGGAGACGACCTTACTGGCTCGACTCGGCCGGCCAGGAGCCCGAGATCCGCGACTACCAGCACATGCTCCGCGTG
CTGAACCACATCGCCACCACGGGCCCGTCGCTTGAGTCGTCTGGCATTCCCATGACAAACGTAATGAGCTATGCC
ATGGGAACTAGCAGTGGTCACGCCGCCTTTCTCGATCCCGACGTCAACGACGCCATGGCCCGTATACTGGCGTTT
TGGCGCAGGTTCCTCGAGAGTCCGGACTCGCGCAACGTGCTGAGATCGAGCAGCGACAGCGGCTGGCTGGGCCCG
ACGACGCTCGAGGCCCTGGAGCGGTTGGGCAACGCGCCCTACAACACGTCGCTCAAGTTCTGCGAGCTGTACCAG
TGCGACAGCAGTGACGAGCACTATGGCTTCAACTCGTGGGACGACTTCTTCGCACGTCGACTCCGGCCTGGGTCG
CGACCCGTAGCATCGCCCGACGACGACAACGTCATAGTAAGCGCCTGCGAGGCCAGCCCGTACAACGTCGTCCGT
GACGTCAAGCTGCGCGACACCTTCTGGGCCAAGGGTCAACCGTACTCGATCCTCGACATGCTGGGCCACGACCCG
GTGGCCGACGAGTTCGCCGGCGGCACCATCTATCAGGCCTTCCTGACGCCCTTGAGCTATCACCGCTGGAACGCT
CCCGTGTCCGGCGTCGTACGGCGTGCCATGATCGTGCCGGGAAACTACTTTTCCATCCCGCTGTCGCTCGATGTC
CGGGACCGTAACGAGACCGAGATCCCCAGCGACGCCGTGGTCCAGTCGCAGGCCTACTTCACCAGCATGTCCACT
CGCGCCGTCATCGTCATCGAGGCCGACAATCCTGCCATCGGACTCATGGCCTTTGTCGCCGTCGGCATGACCGAC
GTCAGCTCGTGCGAGATTGGCGTCCGCGAGGGCCAGCACGTTCGCAAGGGTCAGGAGATAGGCACCTTTCACTAC
GGAGGCTCAACCCACTGCCTGCTGTTCCGCTCGGGCCTCGAGCTCGACGGCCTTCCTCAGGTCGACAATGTGACC
CTGACGCACGTGAACAATGTCCCCGTCAGTGGCCGCCTGGCCGTTGTGAGGGGACCAGCGCAGAAGCGGCGAGTC
TAG
Transcript >Ophcf2|00043
ATGCTCAAACGTCTCCTCTTCTGCCTGGCTGGCTTCGTGTCTCTGGCCCATGCCGGCCCCGAGAACTCCCCTGGA
ACGGTGGCATGGGACTCCCTCCCGAGACACCTCCAGGGTCGCCGGCCCGGGTCTTGGACCGAGGCCGACGTCGCC
GCTCACTCGCGCTTCGTCCGCTCCGTGGCCGCAAAGGCCGATGAGACCCCGACGCTGGAGCTGATCCCGCCCGTC
GCGGCCCTCAAGCGACTGATCGAGACGCAGCCACGCGTCTATATGCACTTTGTCCAGATGTTTGAGCAGATCCCC
TGGAGACGACCTTACTGGCTCGACTCGGCCGGCCAGGAGCCCGAGATCCGCGACTACCAGCACATGCTCCGCGTG
CTGAACCACATCGCCACCACGGGCCCGTCGCTTGAGTCGTCTGGCATTCCCATGACAAACGTAATGAGCTATGCC
ATGGGAACTAGCAGTGGTCACGCCGCCTTTCTCGATCCCGACGTCAACGACGCCATGGCCCGTATACTGGCGTTT
TGGCGCAGGTTCCTCGAGAGTCCGGACTCGCGCAACGTGCTGAGATCGAGCAGCGACAGCGGCTGGCTGGGCCCG
ACGACGCTCGAGGCCCTGGAGCGGTTGGGCAACGCGCCCTACAACACGTCGCTCAAGTTCTGCGAGCTGTACCAG
TGCGACAGCAGTGACGAGCACTATGGCTTCAACTCGTGGGACGACTTCTTCGCACGTCGACTCCGGCCTGGGTCG
CGACCCGTAGCATCGCCCGACGACGACAACGTCATAGTAAGCGCCTGCGAGGCCAGCCCGTACAACGTCGTCCGT
GACGTCAAGCTGCGCGACACCTTCTGGGCCAAGGGTCAACCGTACTCGATCCTCGACATGCTGGGCCACGACCCG
GTGGCCGACGAGTTCGCCGGCGGCACCATCTATCAGGCCTTCCTGACGCCCTTGAGCTATCACCGCTGGAACGCT
CCCGTGTCCGGCGTCGTACGGCGTGCCATGATCGTGCCGGGAAACTACTTTTCCATCCCGCTGTCGCTCGATGTC
CGGGACCGTAACGAGACCGAGATCCCCAGCGACGCCGTGGTCCAGTCGCAGGCCTACTTCACCAGCATGTCCACT
CGCGCCGTCATCGTCATCGAGGCCGACAATCCTGCCATCGGACTCATGGCCTTTGTCGCCGTCGGCATGACCGAC
GTCAGCTCGTGCGAGATTGGCGTCCGCGAGGGCCAGCACGTTCGCAAGGGTCAGGAGATAGGCACCTTTCACTAC
GGAGGCTCAACCCACTGCCTGCTGTTCCGCTCGGGCCTCGAGCTCGACGGCCTTCCTCAGGTCGACAATGTGACC
CTGACGCACGTGAACAATGTCCCCGTCAGTGGCCGCCTGGCCGTTGTGAGGGGACCAGCGCAGAAGCGGCGAGTC
TAG
Gene >Ophcf2|00043
ATGCTCAAACGTCTCCTCTTCTGCCTGGCTGGCTTCGTGTCTCTGGCCCATGCCGGCCCCGAGAACTCCCCTGGA
ACGGTGGCATGGGACTCCCTCCCGAGACACCTCCAGGGTCGCCGGCCCGGGTCTTGGACCGAGGCCGACGTCGCC
GCTCACTCGCGCTTCGTCCGCTCCGTGGCCGCAAAGGCCGATGAGACCCCGACGCTGGAGCTGATCCCGCCCGTC
GCGGCCCTCAAGCGACTGATCGAGACGCAGCCACGCGTCTATATGCACTTTGTCCAGATGTTTGAGCAGATCCCC
TGGAGACGACCTTACTGGCTCGACTCGGCCGGCCAGGAGCCCGAGATCCGCGACTACCAGCACATGCTCCGCGTG
CTGAACCACATCGCCACCACGGGCCCGTCGCTTGAGTCGTCTGGCATTCCCATGACAAACGTAATGAGCTATGCC
ATGGGAACTAGCAGGTACGTCATTGACCAGTTCCCCTGACCCTCGACGAGCTGACTCCTTCTTTCCAGTGGTCAC
GCCGCCTTTCTCGATCCCGACGTCAACGACGCCATGGCCCGTATACTGGCGTTTTGGCGCAGGTTCCTCGAGAGT
CCGGACTCGCGCAACGTGCTGAGATCGAGCAGCGACAGCGGCTGGCTGGGCCCGACGACGCTCGAGGCCCTGGAG
CGGTTGGGCAACGCGCCCTACAACACGTCGCTCAAGTTCTGCGAGCTGTACCAGTGCGACAGCAGTGACGAGCAC
TATGGCTTCAACTCGTGGGACGGTGAGTGCCCAACCCGTCTTCGTTTCCAAGTTGGCATCCAGCTGACAGGCCAA
TCCAGACTTCTTCGCACGTCGACTCCGGCCTGGGTCGCGACCCGTAGCATCGCCCGACGACGACAACGTCATAGT
AAGCGCCTGCGAGGCCAGCCCGTACAACGTCGTCCGTGACGTCAAGCTGCGCGACACCTTCTGGGCCAAGGGTCA
ACCGTACTCGATCCTCGACATGCTGGGCCACGACCCGGTGGCCGACGAGTTCGCCGGCGGCACCATCTATCAGGC
CTTCCTGACGCCCTTGAGCTATCACCGCTGGAACGCTCCCGTGTCCGGCGTCGTACGGCGTGCCATGATCGTGCC
GGGAAACTACTTTTCCATCCCGCTGTCGCTCGATGTCCGGGACCGTAACGAGACCGAGATCCCCAGCGACGCCGT
GGTCCAGTCGCAGGCCTACTTCACCAGCATGTCCACTCGCGCCGTCATCGTCATCGAGGCCGACAATCCTGCCAT
CGGACTCATGGCCTTTGTCGCCGTCGGCATGACCGACGTCAGCTCGTGCGAGATTGGCGTCCGCGAGGGCCAGCA
CGTTCGCAAGGGTCAGGAGATAGGCACCTTTCACTACGGAGGCTCAACCCACTGCCTGCTGTTCCGCTCGGGCCT
CGAGCTCGACGGCCTTCCTCAGGTCGACAATGTGACCCTGACGCACGTGAACAATGTCCCCGTCAGTGGCCGCCT
GGCCGTTGTGAGGGGACCAGCGCAGAAGCGGCGAGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail