Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00028
Gene name
Locationscaffold_01:84060..86419
Strand+
Gene length (bp)2359
Transcript length (bp)2226
Coding sequence length (bp)2226
Protein length (aa) 742

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 454 476 22
2 510 532 22
3 537 559 22
4 566 588 22
5 603 625 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00028
MLSRALVLLCLLSPFLVLAQVTQDGSTVSGVPPEALSALSGSDQQLQKRQGILDGLAGGLKNLVTGFTGDGNKTD
GTGGAGNPLAGIVGKVTDSLLGGFLNLSGPALADAGFLGGVGAGIGAVQGFELLPVDATKAAGDKVAEENGVKRT
SIGDTVQKTTTGLVATALRSFRESNPDLDLASVASSLGSGIGTGTAEGLRLTGQDGASLSNSSDVAGVTSNFAFG
LSRSLADSVDLDKVKALVPNMQQADGSRIASGFARGLMSGVVDGVEAIGGVSSLLGGNATRPVKAAADSDVGFDD
SIGGLATSFGQGLGSAGTLALQRVFSKPRAGDGDGPGLRRRAVDGVGTPAGGLTAGSISAAVQKAVDMLEGPGIG
GIGLILAGLHDSGAVPLNSDGAVRKAAEAIRGLIPPGEFHFTQDGDTFDIDGRQIARVLDGTIFDAAEGIRVNGH
SFGALVALVVLHCVLALLALGFFFPLALTIHSTRNLLVRVDGAHLLPLWTVRVERISSTIVGVPLVLISFILGAV
TVGNGVHFQRVHAFLGVITTVLLLFAAPLFFVSSRRRWFSLVSRVVFQQLLISIMATFVSGLVELSGMTLGLTQV
VPFVLTVAAGGGLGAMLFVAQAVFGFDALLAWRRARVTGRVNEEEEAVRDMFVREVKRVEDVEEIKAKKRENKEK
KEMKGKEKGKKADLETAMPRSISVFEEDDEGESEGQGGTRLESFMAAVLAARGSSEPGWPFNGGRD*
Coding >Ophcf2|00028
ATGCTCTCGCGCGCTCTTGTCCTCCTCTGCCTGCTCTCTCCATTTCTCGTCCTGGCCCAAGTCACGCAAGATGGC
AGCACCGTCAGTGGCGTTCCCCCGGAAGCACTTTCGGCCTTGTCTGGGTCGGATCAGCAGCTGCAGAAGAGGCAG
GGTATCCTCGACGGCTTGGCTGGAGGTCTCAAGAACCTGGTGACCGGCTTTACGGGAGACGGAAACAAGACGGAC
GGCACGGGCGGTGCAGGGAATCCCCTCGCCGGCATCGTGGGCAAGGTGACGGACAGCCTCTTGGGAGGCTTCTTG
AACCTGTCTGGACCTGCCCTTGCCGATGCGGGCTTTCTTGGCGGTGTCGGTGCTGGCATCGGTGCCGTTCAGGGA
TTCGAACTGCTGCCCGTCGACGCAACCAAAGCCGCGGGCGACAAAGTGGCTGAGGAAAACGGCGTGAAGCGGACT
TCTATCGGAGATACGGTGCAGAAGACGACGACGGGCCTCGTGGCCACAGCCCTCCGTTCGTTTCGGGAGAGTAAC
CCTGACCTGGACCTGGCCAGTGTGGCGTCGTCGCTCGGGTCCGGCATCGGGACCGGCACGGCGGAGGGACTGCGG
TTGACGGGCCAAGACGGGGCATCGCTCAGCAACTCGTCCGACGTGGCTGGCGTGACGAGCAACTTTGCCTTTGGT
CTCAGCCGGTCTCTGGCCGACAGTGTCGACTTGGACAAGGTCAAGGCTCTGGTTCCCAACATGCAGCAAGCTGAC
GGGAGCCGGATCGCCAGCGGCTTCGCGAGAGGGCTCATGTCGGGCGTCGTGGACGGAGTTGAGGCCATTGGCGGC
GTCTCCTCCCTCCTAGGAGGCAACGCGACGAGGCCGGTAAAGGCCGCTGCCGACAGCGACGTGGGCTTTGACGAC
TCTATCGGCGGACTGGCTACGAGCTTTGGTCAGGGGCTCGGCAGCGCTGGAACTCTGGCGCTTCAGCGGGTGTTC
TCGAAGCCCCGGGCCGGCGACGGGGATGGTCCGGGGCTACGGAGGCGGGCCGTTGACGGGGTGGGGACGCCGGCC
GGGGGGTTGACGGCGGGGTCGATATCGGCCGCAGTGCAAAAGGCTGTGGACATGCTGGAAGGACCCGGCATCGGG
GGCATCGGCCTCATCCTCGCGGGACTTCACGACAGCGGGGCCGTGCCGTTGAACTCCGACGGCGCGGTGCGGAAG
GCAGCCGAGGCCATTCGGGGGTTGATACCGCCTGGCGAGTTTCACTTTACGCAGGATGGGGACACGTTTGATATC
GACGGCAGGCAGATTGCTCGCGTCCTTGACGGGACTATTTTCGATGCGGCGGAGGGCATCCGGGTTAATGGGCAC
AGCTTTGGAGCTCTGGTCGCTCTGGTTGTTCTTCATTGCGTCCTCGCCCTCCTCGCTCTCGGTTTCTTCTTTCCT
TTGGCTTTGACGATTCATAGCACACGCAACCTGCTGGTTCGTGTCGACGGGGCTCACTTATTACCGCTGTGGACG
GTGAGAGTTGAGCGCATATCGTCCACCATTGTTGGTGTGCCATTGGTGTTGATATCCTTCATCTTGGGGGCGGTC
ACGGTAGGGAATGGTGTGCATTTCCAGAGGGTCCATGCTTTCCTCGGCGTCATCACCACCGTCCTTCTCCTCTTC
GCCGCTCCCCTGTTTTTCGTGTCGAGCCGCAGGCGTTGGTTCTCGCTCGTTTCGCGGGTCGTGTTCCAGCAGCTG
CTCATCTCCATCATGGCCACTTTTGTCTCGGGCCTAGTCGAGCTGAGCGGCATGACGCTGGGTCTGACGCAGGTG
GTTCCCTTTGTGCTGACGGTTGCGGCTGGCGGTGGCCTAGGCGCGATGCTGTTTGTTGCGCAGGCTGTCTTTGGG
TTTGATGCTCTCCTTGCCTGGCGGAGAGCTAGGGTCACGGGGAGGGTGAATGAGGAAGAGGAGGCAGTGAGGGAC
ATGTTTGTCAGGGAGGTCAAGAGGGTTGAAGATGTTGAAGAGATCAAGGCGAAGAAGAGGGAGAACAAGGAAAAG
AAGGAGATGAAAGGGAAGGAGAAGGGGAAGAAGGCGGATTTAGAGACGGCGATGCCGAGGTCCATCTCGGTCTTT
GAGGAGGATGACGAGGGCGAAAGCGAGGGCCAGGGGGGAACAAGGTTAGAGTCATTTATGGCGGCGGTTCTGGCG
GCGAGGGGTTCGAGTGAGCCTGGATGGCCCTTTAATGGAGGGAGGGATTAG
Transcript >Ophcf2|00028
ATGCTCTCGCGCGCTCTTGTCCTCCTCTGCCTGCTCTCTCCATTTCTCGTCCTGGCCCAAGTCACGCAAGATGGC
AGCACCGTCAGTGGCGTTCCCCCGGAAGCACTTTCGGCCTTGTCTGGGTCGGATCAGCAGCTGCAGAAGAGGCAG
GGTATCCTCGACGGCTTGGCTGGAGGTCTCAAGAACCTGGTGACCGGCTTTACGGGAGACGGAAACAAGACGGAC
GGCACGGGCGGTGCAGGGAATCCCCTCGCCGGCATCGTGGGCAAGGTGACGGACAGCCTCTTGGGAGGCTTCTTG
AACCTGTCTGGACCTGCCCTTGCCGATGCGGGCTTTCTTGGCGGTGTCGGTGCTGGCATCGGTGCCGTTCAGGGA
TTCGAACTGCTGCCCGTCGACGCAACCAAAGCCGCGGGCGACAAAGTGGCTGAGGAAAACGGCGTGAAGCGGACT
TCTATCGGAGATACGGTGCAGAAGACGACGACGGGCCTCGTGGCCACAGCCCTCCGTTCGTTTCGGGAGAGTAAC
CCTGACCTGGACCTGGCCAGTGTGGCGTCGTCGCTCGGGTCCGGCATCGGGACCGGCACGGCGGAGGGACTGCGG
TTGACGGGCCAAGACGGGGCATCGCTCAGCAACTCGTCCGACGTGGCTGGCGTGACGAGCAACTTTGCCTTTGGT
CTCAGCCGGTCTCTGGCCGACAGTGTCGACTTGGACAAGGTCAAGGCTCTGGTTCCCAACATGCAGCAAGCTGAC
GGGAGCCGGATCGCCAGCGGCTTCGCGAGAGGGCTCATGTCGGGCGTCGTGGACGGAGTTGAGGCCATTGGCGGC
GTCTCCTCCCTCCTAGGAGGCAACGCGACGAGGCCGGTAAAGGCCGCTGCCGACAGCGACGTGGGCTTTGACGAC
TCTATCGGCGGACTGGCTACGAGCTTTGGTCAGGGGCTCGGCAGCGCTGGAACTCTGGCGCTTCAGCGGGTGTTC
TCGAAGCCCCGGGCCGGCGACGGGGATGGTCCGGGGCTACGGAGGCGGGCCGTTGACGGGGTGGGGACGCCGGCC
GGGGGGTTGACGGCGGGGTCGATATCGGCCGCAGTGCAAAAGGCTGTGGACATGCTGGAAGGACCCGGCATCGGG
GGCATCGGCCTCATCCTCGCGGGACTTCACGACAGCGGGGCCGTGCCGTTGAACTCCGACGGCGCGGTGCGGAAG
GCAGCCGAGGCCATTCGGGGGTTGATACCGCCTGGCGAGTTTCACTTTACGCAGGATGGGGACACGTTTGATATC
GACGGCAGGCAGATTGCTCGCGTCCTTGACGGGACTATTTTCGATGCGGCGGAGGGCATCCGGGTTAATGGGCAC
AGCTTTGGAGCTCTGGTCGCTCTGGTTGTTCTTCATTGCGTCCTCGCCCTCCTCGCTCTCGGTTTCTTCTTTCCT
TTGGCTTTGACGATTCATAGCACACGCAACCTGCTGGTTCGTGTCGACGGGGCTCACTTATTACCGCTGTGGACG
GTGAGAGTTGAGCGCATATCGTCCACCATTGTTGGTGTGCCATTGGTGTTGATATCCTTCATCTTGGGGGCGGTC
ACGGTAGGGAATGGTGTGCATTTCCAGAGGGTCCATGCTTTCCTCGGCGTCATCACCACCGTCCTTCTCCTCTTC
GCCGCTCCCCTGTTTTTCGTGTCGAGCCGCAGGCGTTGGTTCTCGCTCGTTTCGCGGGTCGTGTTCCAGCAGCTG
CTCATCTCCATCATGGCCACTTTTGTCTCGGGCCTAGTCGAGCTGAGCGGCATGACGCTGGGTCTGACGCAGGTG
GTTCCCTTTGTGCTGACGGTTGCGGCTGGCGGTGGCCTAGGCGCGATGCTGTTTGTTGCGCAGGCTGTCTTTGGG
TTTGATGCTCTCCTTGCCTGGCGGAGAGCTAGGGTCACGGGGAGGGTGAATGAGGAAGAGGAGGCAGTGAGGGAC
ATGTTTGTCAGGGAGGTCAAGAGGGTTGAAGATGTTGAAGAGATCAAGGCGAAGAAGAGGGAGAACAAGGAAAAG
AAGGAGATGAAAGGGAAGGAGAAGGGGAAGAAGGCGGATTTAGAGACGGCGATGCCGAGGTCCATCTCGGTCTTT
GAGGAGGATGACGAGGGCGAAAGCGAGGGCCAGGGGGGAACAAGGTTAGAGTCATTTATGGCGGCGGTTCTGGCG
GCGAGGGGTTCGAGTGAGCCTGGATGGCCCTTTAATGGAGGGAGGGATTAG
Gene >Ophcf2|00028
ATGCTCTCGCGCGCTCTTGTCCTCCTCTGCCTGCTCTCTCCATTTCTCGTCCTGGCCCAAGTCACGCAAGATGGC
AGCACCGTCAGTGGCGTTCCCCCGGAAGCACTTTCGGCCTTGTCTGGGTCGGATCAGCAGCTGCAGAAGAGGCAG
GGTATCCTCGACGGCTTGGCTGGAGGTCTCAAGAACCTGGTGACCGGCTTTACGGGAGACGGAAACAAGACGGAC
GGCACGGGCGGTGCAGGGAATCCCCTCGCCGGCATCGTGGGCAAGGTGACGGACAGCCTCTTGGGAGGCTTCTTG
AACCTGTCTGGACCTGCCCTTGCCGATGCGGGCTTTCTTGGCGGTGTCGGTGCTGGCATCGGTGCCGTTCAGGGA
TTCGAACTGCTGCCCGTCGACGCAACCAAAGCCGCGGGCGACAAAGTGGCTGAGGAAAACGGCGTGAAGCGGACT
TCTATCGGAGATACGGTGCAGAAGACGACGACGGGCCTCGTGGCCACAGCCCTCCGTTCGTTTCGGGAGAGTAAC
CCTGACCTGGACCTGGCCAGTGTGGCGTCGTCGCTCGGGTCCGGCATCGGGACCGGCACGGCGGAGGGACTGCGG
TTGACGGGCCAAGACGGGGCATCGCTCAGCAACTCGTCCGACGTGGCTGGCGTGACGAGCAACTTTGCCTTTGGT
CTCAGCCGGTCTCTGGCCGACAGTGTCGACTTGGACAAGGTCAAGGCTCTGGTTCCCAACATGCAGCAAGCTGAC
GGGAGCCGGATCGCCAGCGGCTTCGCGAGAGGGCTCATGTCGGGCGTCGTGGACGGAGTTGAGGCCATTGGCGGC
GTCTCCTCCCTCCTAGGAGGCAACGCGACGAGGCCGGTAAAGGCCGCTGCCGACAGCGACGTGGGCTTTGACGAC
TCTATCGGCGGACTGGCTACGAGCTTTGGTCAGGGGCTCGGCAGCGCTGGAACTCTGGCGCTTCAGCGGGTGTTC
TCGAAGCCCCGGGCCGGCGACGGGGATGGTCCGGGGCTACGGAGGCGGGCCGTTGACGGGGTGGGGACGCCGGCC
GGGGGGTTGACGGCGGGGTCGATATCGGCCGCAGTGCAAAAGGCTGTGGACATGCTGGAAGGACCCGGCATCGGG
GGCATCGGCCTCATCCTCGCGGGACTTCACGACAGCGGGGCCGTGCCGTTGAACTCCGACGGCGCGGTGCGGAAG
GCAGCCGAGGCCATTCGGGGGTTGATACCGCCTGGCGAGTTTCACTTTACGCAGGATGGGGACACGTTTGATATC
GACGGCAGGCAGATTGCTCGCGTCCTTGACGGGACTATTTTCGATGCGGCGGAGGGCATCCGGGTTAATGGGCAC
AGCTTTGGAGCTCTGGTCGCTCTGGTTGTTCTTCATTGTGAGGCCCTCTCCTTTCTATCTCGATTGAGGCATTCA
GCTGACGGTTCGCGCAGGCGTCCTCGCCCTCCTCGCTCTCGGTTTCTTCTTTCCTTTGGCTTTGACGATTCATAG
CACACGCAACCTGCTGGTTCGTGTCGACGGGGCTCACTTATTACCGCTGTGGACGGTGAGAGTTGAGCGCATATC
GTCCACCATTGTTGGTGTGCCATTGGTGTTGATATCCTTCATCTTGGGGGCGGTCACGGTAGGGAATGGTGTGCA
TTTCCAGAGGGTCCATGCTGTGGGTTTCATTTTCCTTGTTCCTTTTTCTTCTGTTCTTGTTCTTTTTGAGTGAAT
TGCTGTGCTGACGTGTTGTCAGTTCCTCGGCGTCATCACCACCGTCCTTCTCCTCTTCGCCGCTCCCCTGTTTTT
CGTGTCGAGCCGCAGGCGTTGGTTCTCGCTCGTTTCGCGGGTCGTGTTCCAGCAGCTGCTCATCTCCATCATGGC
CACTTTTGTCTCGGGCCTAGTCGAGCTGAGCGGCATGACGCTGGGTCTGACGCAGGTGGTTCCCTTTGTGCTGAC
GGTTGCGGCTGGCGGTGGCCTAGGCGCGATGCTGTTTGTTGCGCAGGCTGTCTTTGGGTTTGATGCTCTCCTTGC
CTGGCGGAGAGCTAGGGTCACGGGGAGGGTGAATGAGGAAGAGGAGGCAGTGAGGGACATGTTTGTCAGGGAGGT
CAAGAGGGTTGAAGATGTTGAAGAGATCAAGGCGAAGAAGAGGGAGAACAAGGAAAAGAAGGAGATGAAAGGGAA
GGAGAAGGGGAAGAAGGCGGATTTAGAGACGGCGATGCCGAGGTCCATCTCGGTCTTTGAGGAGGATGACGAGGG
CGAAAGCGAGGGCCAGGGGGGAACAAGGTTAGAGTCATTTATGGCGGCGGTTCTGGCGGCGAGGGGTTCGAGTGA
GCCTGGATGGCCCTTTAATGGAGGGAGGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail