Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00026
Gene name
Locationscaffold_01:71970..80132
Strand+
Gene length (bp)8162
Transcript length (bp)7644
Coding sequence length (bp)7644
Protein length (aa) 2548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 3.3E-70 5 256
PF08659 KR KR domain 8.5E-64 2156 2333
PF00698 Acyl_transf_1 Acyl transferase domain 1.3E-48 526 809
PF14765 PS-DH Polyketide synthase dehydratase 1.7E-47 905 1189
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 6.0E-28 266 368
PF08242 Methyltransf_12 Methyltransferase domain 6.0E-18 1419 1526
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 3.3E-16 371 494
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 8.5E-15 1959 2061
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 9.7E-12 1997 2132
PF00106 adh_short short chain dehydrogenase 2.7E-11 2159 2306
PF13649 Methyltransf_25 Methyltransferase domain 4.4E-11 1418 1524
PF13489 Methyltransf_23 Methyltransferase domain 9.1E-11 1412 1576
PF08241 Methyltransf_11 Methyltransferase domain 1.0E-09 1419 1528
PF13847 Methyltransf_31 Methyltransferase domain 3.3E-08 1413 1532
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.7E-06 1410 1534
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.4E-05 1842 1896
PF00550 PP-binding Phosphopantetheine attachment site 5.0E-05 2461 2512

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00026
MAPVDIAIVGLACRFPGEAKSPKAFYQMLVQGRDAWSKVPKSRYDVDAYRHPSRERRGTMVCEGGYFLEDDVSRW
DAPFFACSTVEANAMDPQQRLLLEVAYESLENAGIPMEALAESDAACFVGGFTNDYQRIVTSESEATPQYTMTGN
STAMMANRVSWFLNLRGPSVTVDTACSSSMAAFHLACETIRSESNETRCAMVGGTSLLFNPDDPCGMNALGFLSP
DSRCYSFDSRANGYARGEGVAMLVLKHIDDALRDGDAIRGVTAGIVLPNGEAHQRLINHTYRLAGFHPADTQYAE
LHGTGTRVGDPTEISAVARTLAADRSTPLLCGSVKTQIGHSEAAAAMAGILKCVLSMEAGILPPNKNFIEPNPRL
RLEASNIVVPTESQPWPLTAVRRCSINSFGFGGLNGHIILDGAAGYLGSRGLAVPDVDADAEAEARPRLFLLSAP
EQSAVARQLRAHADYLTASSPPVSLPLLAHTLGARRSVFQWRLAVVARSADELESLWRQDGPVPIKAVASPGVAL
VFTGQGAQWHAMGRELLTLPAFARSVRASAAALVALGCPWDAWTELTRPETESRVGQAVYSQPLTSLLQIALVDL
LRYWGVTPAAVVGHSSGEMAAAYAVGALSREDCLAIAYHRGLVSEMAAQREPGGAMMAVGLSADEIRPRLVSSDI
TVACINSPNNVTLAGDAAALEKLAESLKRDDVFCRILKVQNAFHSPQMQTVAEEYRRRIAGVKPVDVTAVFHSTV
HGCRIPTSKLTADYWVANLCSPVELVRALDDMLCTKEGKGKRSKAPTIIVEVGPHGVLAGPFEQFRLARRGLEHL
GYYSLLSRGRDAMVTAMTAASALWMRGVAVRVDKINDLDGASRPATVLTDMPSYSWNHSVSYWHETWGSRNRRWP
SAPKHDLIGWRLPACNPLEPVWKNYLRVGEIPWLKDHQVHGDVVFPAAGVISAVIEAMRQFESGHDITSFELREF
YIPRPLLIPSTELGAETFLHLKRRKTGMGSGAGPWLEFSFYSRQDDDTFVEHAHGLVQAHFAKQSNEVDGGRELR
EETLAHQRRFQHQVKTCDEPLTSQAHYDFCRSIGLVYGDNFQGLCNVRLKDTNVAFEVSVVDTPACMPGAWESDY
LVHPTTIDLLFQALLATLPNMRNAEKQGWAPTAVGSIRVSTAIRRGPGTVLQGYGELSAGAAHQMVGFVMAGDGV
FDSFPGVVMDGIQVSALGTMQNASVNASEESSVKLYATPAWKPDLLLLEGRRPARLAVGAARDHCAARFSIDSRA
IVDEMCGAALQGLDDEAIAALTPHLQQYVGWMQKRTSEARTFASITPPISPGFSAYDVKVDEYFSIDKLKSFIDR
FPVDGRLLQHAFACIDPIFSGETTPIAALMASDDFARFYKESNGAEVMIPIFRNWFDLKAHKKPGLRVLEVGGGT
GAMTVPILETMGDTEGETPRFSGFTFTDISPGWFEGARTLLRRWKSRVDYKVLNIEVDPVEQGFEPESYDVIVAF
NVLHATKSIKTSLENCRRLLKPGGNLIVGECTNPDDMLSFIFGLLPGWWAAEDGRQFGPLLSESAWDKTLKDAGF
SGTDIAMPDGDDEAGHHRMSVMVGTKPHEQEAPSSTRDVVILVANNGINDAGKSLAASVRRDLEQLEARVNIKVL
GSSEMKFEGKTVISLLEYGAPILQEVQEADFEHIKHVLLHCRELLWVTRSDAADKEGHPSMRIISGLLHCLKNED
ASRRLHELHLCRNVTASVAETSDIILRRLNSLWQGEGEEAAELVTVERDGEFCIPRYVPEKTMNRSLARTTDTDL
ELQTEKLVQAGRPMRLKIGRPGMLDTLHFGDDDEALQPLAEDEVMIEVLACGLNFRDVLIAMGELRSPNLGYEAA
GIIIGTGAKVTRLSVGDRVLCLRPAVMRTRIRTNQWHVHLLPACLSIENGVTIPVAYATAYRCLVEVARLEKGET
VLIHAAAGGFGQASIHMAKMLGADIFCTVSTEAKKRLVVSLGVKPEHVFSSRDVSFEAGIKRVTNGRGVDVVVNS
LAGELLRRSWACMAPYGRFVEVGKRDIVGNSGLDMQPFDNNAVFACVNLDAMTSEPRRLWELVDKVLRLFEQGSL
GLIQPIAVHDFSDLEAVFREMQRGAHMGKLALRVTPESRVPVAPRKTVPLKLSPDATYLLAGGLGGLGRAQALFM
VEHGARHLAFVSRSGDSRPEARKLLDTLAKAGVKTRAYAGDVADRDGLEAILDDVARRMPPIRGVIQGAMVLDDA
LFQNMSYDQWQKATRPKIQGSWNLHELLPADLDFFVVLSSMAGAIGFVSQANYAAGNTFQDALAHYRHAQGLPAL
SIDLGITKGFGYVAEHEEVAAKLKPYGLATVNEQQLFHLLRCAMAGTADGDKKLPTRQLLAGAGTGGLAQASLAT
VPETNLFWLSALASFSYLGEVDMRASAEMAGEEMTDDARLVDRLSASKTMDEAAEVVQDMLLARISTIMSLPTAD
IDTAKPVHAYGVDSLVAVELRNWLSKRLRSDVSIFDLTGNMAITTLSRKIASRSRLVPTAAKGQGGNETGAE*
Coding >Ophcf2|00026
ATGGCTCCTGTTGACATCGCCATCGTCGGGCTCGCGTGCCGCTTTCCCGGTGAGGCCAAGTCTCCAAAGGCCTTT
TACCAGATGCTGGTGCAAGGCCGCGATGCTTGGTCCAAAGTGCCCAAATCACGATACGATGTCGACGCGTACCGT
CACCCGTCGCGTGAGCGTCGCGGGACAATGGTTTGCGAAGGCGGCTACTTTTTAGAAGACGACGTCTCTCGATGG
GACGCGCCCTTCTTCGCCTGCTCGACCGTCGAGGCGAATGCCATGGATCCGCAGCAGAGGCTTCTACTCGAAGTC
GCCTACGAGAGCCTGGAGAACGCGGGCATCCCGATGGAGGCTTTGGCCGAGAGTGACGCGGCCTGCTTCGTCGGC
GGCTTCACCAACGACTACCAGCGCATCGTGACGAGCGAGTCGGAGGCGACGCCACAGTATACCATGACGGGCAAT
TCGACGGCCATGATGGCCAACCGTGTCAGCTGGTTCCTCAACCTACGCGGGCCGTCGGTGACGGTCGACACGGCC
TGCTCCAGCTCCATGGCGGCGTTTCATCTGGCTTGCGAGACGATTCGGTCCGAGTCCAACGAAACGCGGTGCGCC
ATGGTCGGCGGCACCAGCCTGCTGTTCAACCCGGACGATCCATGCGGTATGAATGCGCTGGGCTTCCTGAGCCCG
GATAGCCGATGCTATAGCTTCGACTCGCGGGCCAACGGCTACGCGCGTGGTGAGGGCGTCGCGATGCTGGTGCTC
AAGCACATAGATGACGCATTGCGAGACGGAGACGCCATTCGGGGCGTGACGGCCGGCATCGTCCTCCCAAACGGA
GAGGCTCATCAGCGCCTCATCAATCACACCTATCGCCTCGCGGGCTTCCATCCGGCCGATACGCAGTATGCCGAG
CTTCACGGCACCGGCACTCGCGTCGGCGATCCCACCGAGATCAGCGCCGTGGCCCGGACCCTCGCCGCCGATCGA
TCCACGCCGTTGCTATGTGGCTCCGTCAAGACGCAGATTGGTCACTCCGAGGCGGCCGCCGCCATGGCCGGCATC
CTCAAATGCGTCCTCTCCATGGAGGCTGGCATCCTACCGCCGAACAAGAACTTTATCGAGCCAAACCCGCGGCTC
CGGCTCGAGGCCTCCAACATCGTGGTGCCAACCGAGTCGCAGCCGTGGCCTTTAACCGCCGTCCGCCGCTGCTCT
ATCAATAGCTTCGGTTTCGGCGGGCTCAACGGTCACATCATCCTCGACGGCGCCGCTGGCTACCTCGGCAGCCGC
GGGCTCGCCGTTCCAGACGTCGATGCCGACGCCGAAGCAGAAGCCCGGCCCCGACTCTTCCTCCTCTCCGCTCCG
GAACAGAGCGCCGTGGCCCGCCAGCTCCGCGCTCACGCCGACTACCTGACCGCCTCCTCGCCGCCCGTCTCTCTG
CCGCTCCTCGCTCACACGCTGGGCGCCCGCCGCTCCGTCTTCCAGTGGCGCCTCGCCGTCGTCGCCCGCTCTGCC
GACGAGCTTGAGTCCCTCTGGCGTCAGGATGGGCCGGTACCTATCAAGGCCGTTGCCTCGCCTGGTGTGGCTCTC
GTCTTCACTGGCCAGGGCGCCCAGTGGCACGCCATGGGCCGCGAGCTGCTGACCCTGCCCGCCTTTGCCCGCTCC
GTCCGCGCCTCGGCCGCTGCGCTGGTCGCCCTGGGGTGTCCCTGGGATGCTTGGACCGAGCTCACGCGTCCGGAA
ACCGAGTCGCGCGTTGGACAGGCCGTCTACTCCCAGCCGTTGACGTCGCTACTTCAGATTGCCCTCGTCGACCTC
CTCCGGTACTGGGGTGTCACGCCGGCCGCCGTCGTTGGCCATTCGTCGGGTGAGATGGCGGCCGCTTATGCCGTC
GGCGCCCTATCCCGCGAGGACTGCCTTGCCATCGCCTATCACCGCGGTCTGGTATCTGAAATGGCAGCTCAACGC
GAGCCCGGCGGCGCCATGATGGCCGTCGGTCTGTCTGCCGACGAGATCAGGCCGCGACTGGTCAGCTCCGACATC
ACCGTAGCTTGCATCAACAGTCCCAATAACGTGACGCTGGCGGGTGACGCCGCGGCTCTAGAGAAGCTCGCCGAG
TCTCTGAAGCGCGACGACGTCTTCTGCCGCATTCTCAAGGTTCAGAACGCATTTCACAGTCCGCAGATGCAGACT
GTGGCCGAGGAGTACCGTCGACGTATCGCCGGCGTCAAGCCCGTCGACGTTACGGCCGTCTTTCACTCCACCGTT
CACGGCTGCCGGATCCCCACGTCGAAGCTGACGGCCGACTACTGGGTGGCTAATCTCTGCTCTCCTGTCGAGCTC
GTCCGGGCCCTGGACGACATGCTGTGCACCAAAGAAGGCAAGGGTAAGAGATCCAAAGCACCCACTATCATAGTT
GAAGTCGGGCCACACGGCGTCCTCGCCGGCCCCTTCGAGCAGTTTCGGCTCGCTCGCCGCGGCCTCGAGCACCTC
GGCTACTACAGTCTTCTCTCACGGGGACGGGACGCCATGGTTACGGCAATGACAGCCGCTTCTGCTCTCTGGATG
AGGGGTGTTGCTGTTCGGGTCGACAAGATTAATGACTTGGACGGGGCCTCTCGGCCCGCCACTGTCCTCACCGAT
ATGCCGTCCTACAGCTGGAATCACTCCGTCTCGTACTGGCACGAGACGTGGGGCTCACGAAACCGCCGCTGGCCA
TCGGCTCCCAAGCACGATCTGATCGGCTGGCGGCTCCCTGCGTGCAACCCGCTGGAGCCCGTGTGGAAGAATTAC
CTGCGCGTCGGCGAGATTCCCTGGCTCAAGGATCACCAGGTGCACGGCGACGTCGTGTTTCCCGCCGCCGGCGTC
ATCAGCGCCGTCATCGAGGCCATGCGCCAATTTGAAAGCGGCCACGACATTACGAGCTTCGAGCTCCGCGAGTTC
TACATCCCCCGGCCCCTCCTCATCCCCAGCACCGAGCTCGGCGCTGAGACCTTCCTTCACCTCAAGCGCAGAAAG
ACGGGCATGGGCAGCGGGGCCGGCCCCTGGCTCGAATTCTCCTTTTACTCGCGTCAGGACGACGACACCTTCGTC
GAGCACGCCCATGGCCTCGTCCAGGCTCACTTTGCGAAGCAGTCAAATGAGGTGGACGGGGGCAGGGAGCTGAGG
GAGGAGACGTTGGCCCACCAGAGACGCTTTCAGCACCAGGTCAAAACGTGCGACGAGCCGCTCACCAGCCAAGCT
CACTACGATTTTTGCAGAAGCATAGGCCTCGTTTACGGCGACAACTTCCAGGGCCTGTGCAATGTGCGGCTCAAA
GACACCAACGTCGCCTTTGAGGTTTCCGTCGTCGACACCCCGGCCTGCATGCCGGGAGCGTGGGAGTCGGATTAC
CTCGTTCACCCGACGACTATCGACCTCTTGTTCCAGGCCCTCCTTGCGACTCTGCCCAACATGAGGAACGCCGAG
AAGCAGGGATGGGCCCCGACGGCCGTCGGCTCGATCCGTGTCTCGACAGCTATTCGACGCGGTCCCGGCACGGTA
CTCCAGGGCTACGGCGAGCTGTCCGCCGGGGCGGCCCATCAGATGGTTGGCTTCGTCATGGCGGGCGACGGCGTC
TTCGACTCGTTCCCTGGAGTTGTCATGGACGGAATCCAAGTCTCGGCTCTAGGCACCATGCAGAACGCGTCGGTC
AACGCGTCCGAGGAGTCGAGTGTCAAGCTGTACGCGACGCCCGCCTGGAAGCCGGACCTGCTTCTTCTCGAGGGA
CGACGTCCGGCGCGACTAGCCGTGGGGGCGGCTCGGGACCACTGCGCGGCTCGGTTCAGCATCGACAGCCGCGCG
ATCGTCGACGAAATGTGCGGCGCCGCGTTGCAGGGGCTGGACGACGAGGCCATCGCTGCGCTGACCCCCCATTTG
CAACAGTATGTCGGCTGGATGCAGAAGCGCACCAGCGAGGCCAGGACGTTTGCCAGCATCACGCCCCCCATTAGC
CCGGGCTTCAGCGCCTACGACGTCAAGGTGGACGAGTACTTCAGCATCGATAAGCTCAAGAGCTTCATTGACAGG
TTTCCTGTCGACGGGCGCCTTTTGCAGCACGCCTTTGCCTGCATCGACCCCATCTTCAGCGGGGAGACGACGCCG
ATCGCGGCCCTGATGGCGAGCGACGATTTCGCCCGCTTCTACAAGGAGTCCAACGGTGCCGAGGTCATGATACCC
ATCTTCCGCAACTGGTTCGACCTCAAGGCGCACAAGAAGCCAGGCCTGCGCGTTCTCGAAGTCGGGGGCGGCACG
GGCGCTATGACGGTGCCCATTCTGGAGACGATGGGAGACACCGAGGGCGAGACGCCGCGTTTCTCGGGCTTTACC
TTCACCGACATCTCACCTGGCTGGTTTGAGGGCGCTCGGACGCTGCTGCGTCGCTGGAAGTCTCGTGTTGATTAC
AAGGTGCTCAACATTGAGGTTGATCCTGTTGAGCAAGGCTTCGAGCCTGAGTCTTATGATGTGATCGTGGCTTTC
AATGTCCTTCACGCGACGAAAAGCATAAAAACGTCGCTCGAAAACTGCCGCCGGCTGCTCAAGCCCGGAGGCAAC
CTCATCGTCGGCGAATGCACCAATCCTGACGATATGCTCAGCTTCATCTTCGGCCTCTTGCCCGGCTGGTGGGCC
GCCGAGGACGGCAGGCAGTTTGGCCCCTTGCTGAGCGAGTCCGCCTGGGACAAGACGCTCAAGGATGCTGGCTTC
TCCGGCACCGATATCGCCATGCCGGACGGCGACGATGAGGCTGGCCATCATCGGATGTCGGTCATGGTCGGTACC
AAGCCGCACGAGCAGGAGGCTCCCTCTTCGACCAGAGACGTTGTTATTCTCGTGGCCAACAATGGCATCAACGAC
GCCGGAAAAAGCCTCGCCGCCTCCGTCCGCCGTGATCTTGAGCAGCTCGAAGCCCGCGTCAACATCAAGGTGTTG
GGATCGTCCGAGATGAAGTTCGAGGGCAAGACGGTCATCTCTCTCTTGGAATACGGCGCGCCGATTCTCCAAGAG
GTCCAGGAAGCCGACTTTGAGCACATCAAGCATGTCTTGCTCCATTGCCGCGAGCTCCTCTGGGTCACACGCTCG
GATGCAGCGGACAAGGAGGGGCATCCCAGCATGCGCATCATCTCGGGCCTGCTTCACTGTCTCAAGAACGAGGAC
GCGTCTCGAAGGCTTCACGAGCTGCATCTTTGTCGGAACGTCACGGCCAGCGTCGCCGAGACCAGCGACATCATT
CTCCGCAGACTCAACAGTCTGTGGCAAGGTGAAGGAGAAGAGGCAGCGGAGCTTGTCACGGTGGAACGAGACGGC
GAATTCTGCATTCCCCGTTACGTGCCGGAAAAGACGATGAACCGCAGCCTGGCGCGCACGACCGATACTGATCTG
GAGCTACAGACAGAGAAGCTCGTGCAAGCCGGCCGGCCAATGCGGCTCAAGATCGGGCGGCCGGGGATGTTGGAT
ACGCTTCATTTTGGCGACGATGATGAGGCCTTGCAGCCGCTGGCCGAAGACGAGGTCATGATTGAGGTGTTGGCG
TGTGGCCTCAACTTCCGGGACGTCTTGATCGCCATGGGCGAGCTCCGGTCGCCGAATCTGGGCTACGAGGCAGCC
GGAATCATCATCGGCACCGGGGCCAAAGTGACGCGGCTGTCGGTCGGCGATCGGGTCCTGTGCCTGAGGCCGGCC
GTGATGCGCACGCGGATCCGCACCAACCAGTGGCACGTCCATCTGCTACCGGCCTGCTTGTCGATTGAGAACGGC
GTGACGATTCCGGTGGCGTACGCGACTGCGTACCGATGTCTTGTCGAGGTGGCGAGGCTGGAAAAGGGGGAGACG
GTTCTGATTCACGCGGCAGCGGGAGGCTTCGGGCAGGCTTCGATTCACATGGCCAAGATGCTAGGTGCCGACATC
TTCTGTACGGTCAGCACCGAGGCTAAGAAGCGGCTGGTCGTCTCGCTCGGAGTCAAGCCCGAGCACGTCTTTAGC
TCGCGTGATGTCTCGTTCGAGGCGGGCATTAAGAGGGTCACTAACGGCCGTGGCGTCGACGTCGTCGTCAATTCG
CTTGCGGGCGAGCTGCTACGCCGGAGTTGGGCCTGTATGGCTCCCTACGGCCGCTTCGTCGAGGTCGGCAAACGG
GACATCGTGGGCAACAGCGGGCTAGACATGCAGCCGTTCGATAACAACGCCGTATTCGCGTGCGTTAACCTCGAT
GCCATGACGTCGGAGCCGCGGCGGCTATGGGAGCTGGTGGACAAGGTGCTTCGCTTGTTCGAGCAGGGCTCTCTA
GGACTGATCCAGCCCATTGCCGTTCACGACTTCTCCGACCTCGAAGCCGTCTTCCGCGAGATGCAGCGAGGAGCG
CACATGGGCAAGCTGGCCCTGCGCGTGACACCCGAGTCGCGGGTTCCGGTTGCGCCGCGCAAGACGGTGCCCCTG
AAGCTGTCGCCGGATGCGACATACCTGCTGGCCGGCGGCCTCGGTGGACTTGGCCGGGCCCAGGCTCTGTTTATG
GTCGAACACGGGGCCCGGCACTTGGCCTTTGTGTCGCGGTCCGGCGACTCGCGGCCCGAGGCCCGGAAGCTGCTG
GACACGCTGGCGAAGGCCGGGGTCAAGACCCGCGCCTACGCCGGCGACGTGGCCGACCGCGACGGGCTAGAGGCC
ATCCTCGACGACGTGGCGCGCCGCATGCCGCCTATCCGCGGAGTCATTCAGGGCGCCATGGTGCTCGACGACGCC
CTCTTCCAGAACATGTCATACGACCAGTGGCAGAAGGCGACGCGGCCCAAGATCCAGGGCAGCTGGAACCTTCAC
GAGTTGCTGCCGGCCGATCTCGACTTCTTCGTCGTCCTCTCCTCCATGGCTGGGGCCATCGGCTTCGTCTCCCAG
GCCAACTACGCGGCCGGCAACACGTTCCAGGACGCGCTGGCTCATTACCGGCACGCCCAAGGTCTGCCAGCATTG
AGCATCGACCTCGGCATCACAAAGGGCTTTGGTTACGTGGCCGAGCACGAAGAGGTGGCGGCCAAGCTAAAGCCG
TACGGACTGGCGACGGTTAACGAGCAGCAGCTATTTCACCTACTACGATGTGCAATGGCCGGCACCGCCGACGGC
GACAAGAAGCTGCCTACGCGGCAGCTGCTCGCCGGGGCCGGTACGGGGGGGTTGGCTCAGGCGTCACTCGCGACG
GTGCCCGAGACGAACCTGTTCTGGCTATCGGCCCTGGCGTCCTTCTCTTACCTTGGTGAGGTGGACATGAGGGCC
TCGGCCGAGATGGCAGGCGAGGAGATGACGGACGACGCGCGGCTCGTCGACCGGCTATCAGCGTCCAAGACGATG
GACGAGGCTGCCGAGGTGGTGCAGGATATGCTGCTTGCGCGCATCTCGACCATCATGTCGCTGCCGACGGCTGAC
ATCGATACGGCCAAGCCGGTTCACGCGTACGGCGTCGACAGCCTGGTGGCCGTTGAGCTAAGAAACTGGCTGTCG
AAGCGGCTGCGCAGCGACGTCAGCATCTTTGACCTGACGGGCAACATGGCCATTACGACGCTGAGCCGGAAGATT
GCTAGTCGGTCGCGCCTGGTTCCCACTGCAGCCAAGGGGCAGGGCGGCAACGAGACTGGTGCTGAGTGA
Transcript >Ophcf2|00026
ATGGCTCCTGTTGACATCGCCATCGTCGGGCTCGCGTGCCGCTTTCCCGGTGAGGCCAAGTCTCCAAAGGCCTTT
TACCAGATGCTGGTGCAAGGCCGCGATGCTTGGTCCAAAGTGCCCAAATCACGATACGATGTCGACGCGTACCGT
CACCCGTCGCGTGAGCGTCGCGGGACAATGGTTTGCGAAGGCGGCTACTTTTTAGAAGACGACGTCTCTCGATGG
GACGCGCCCTTCTTCGCCTGCTCGACCGTCGAGGCGAATGCCATGGATCCGCAGCAGAGGCTTCTACTCGAAGTC
GCCTACGAGAGCCTGGAGAACGCGGGCATCCCGATGGAGGCTTTGGCCGAGAGTGACGCGGCCTGCTTCGTCGGC
GGCTTCACCAACGACTACCAGCGCATCGTGACGAGCGAGTCGGAGGCGACGCCACAGTATACCATGACGGGCAAT
TCGACGGCCATGATGGCCAACCGTGTCAGCTGGTTCCTCAACCTACGCGGGCCGTCGGTGACGGTCGACACGGCC
TGCTCCAGCTCCATGGCGGCGTTTCATCTGGCTTGCGAGACGATTCGGTCCGAGTCCAACGAAACGCGGTGCGCC
ATGGTCGGCGGCACCAGCCTGCTGTTCAACCCGGACGATCCATGCGGTATGAATGCGCTGGGCTTCCTGAGCCCG
GATAGCCGATGCTATAGCTTCGACTCGCGGGCCAACGGCTACGCGCGTGGTGAGGGCGTCGCGATGCTGGTGCTC
AAGCACATAGATGACGCATTGCGAGACGGAGACGCCATTCGGGGCGTGACGGCCGGCATCGTCCTCCCAAACGGA
GAGGCTCATCAGCGCCTCATCAATCACACCTATCGCCTCGCGGGCTTCCATCCGGCCGATACGCAGTATGCCGAG
CTTCACGGCACCGGCACTCGCGTCGGCGATCCCACCGAGATCAGCGCCGTGGCCCGGACCCTCGCCGCCGATCGA
TCCACGCCGTTGCTATGTGGCTCCGTCAAGACGCAGATTGGTCACTCCGAGGCGGCCGCCGCCATGGCCGGCATC
CTCAAATGCGTCCTCTCCATGGAGGCTGGCATCCTACCGCCGAACAAGAACTTTATCGAGCCAAACCCGCGGCTC
CGGCTCGAGGCCTCCAACATCGTGGTGCCAACCGAGTCGCAGCCGTGGCCTTTAACCGCCGTCCGCCGCTGCTCT
ATCAATAGCTTCGGTTTCGGCGGGCTCAACGGTCACATCATCCTCGACGGCGCCGCTGGCTACCTCGGCAGCCGC
GGGCTCGCCGTTCCAGACGTCGATGCCGACGCCGAAGCAGAAGCCCGGCCCCGACTCTTCCTCCTCTCCGCTCCG
GAACAGAGCGCCGTGGCCCGCCAGCTCCGCGCTCACGCCGACTACCTGACCGCCTCCTCGCCGCCCGTCTCTCTG
CCGCTCCTCGCTCACACGCTGGGCGCCCGCCGCTCCGTCTTCCAGTGGCGCCTCGCCGTCGTCGCCCGCTCTGCC
GACGAGCTTGAGTCCCTCTGGCGTCAGGATGGGCCGGTACCTATCAAGGCCGTTGCCTCGCCTGGTGTGGCTCTC
GTCTTCACTGGCCAGGGCGCCCAGTGGCACGCCATGGGCCGCGAGCTGCTGACCCTGCCCGCCTTTGCCCGCTCC
GTCCGCGCCTCGGCCGCTGCGCTGGTCGCCCTGGGGTGTCCCTGGGATGCTTGGACCGAGCTCACGCGTCCGGAA
ACCGAGTCGCGCGTTGGACAGGCCGTCTACTCCCAGCCGTTGACGTCGCTACTTCAGATTGCCCTCGTCGACCTC
CTCCGGTACTGGGGTGTCACGCCGGCCGCCGTCGTTGGCCATTCGTCGGGTGAGATGGCGGCCGCTTATGCCGTC
GGCGCCCTATCCCGCGAGGACTGCCTTGCCATCGCCTATCACCGCGGTCTGGTATCTGAAATGGCAGCTCAACGC
GAGCCCGGCGGCGCCATGATGGCCGTCGGTCTGTCTGCCGACGAGATCAGGCCGCGACTGGTCAGCTCCGACATC
ACCGTAGCTTGCATCAACAGTCCCAATAACGTGACGCTGGCGGGTGACGCCGCGGCTCTAGAGAAGCTCGCCGAG
TCTCTGAAGCGCGACGACGTCTTCTGCCGCATTCTCAAGGTTCAGAACGCATTTCACAGTCCGCAGATGCAGACT
GTGGCCGAGGAGTACCGTCGACGTATCGCCGGCGTCAAGCCCGTCGACGTTACGGCCGTCTTTCACTCCACCGTT
CACGGCTGCCGGATCCCCACGTCGAAGCTGACGGCCGACTACTGGGTGGCTAATCTCTGCTCTCCTGTCGAGCTC
GTCCGGGCCCTGGACGACATGCTGTGCACCAAAGAAGGCAAGGGTAAGAGATCCAAAGCACCCACTATCATAGTT
GAAGTCGGGCCACACGGCGTCCTCGCCGGCCCCTTCGAGCAGTTTCGGCTCGCTCGCCGCGGCCTCGAGCACCTC
GGCTACTACAGTCTTCTCTCACGGGGACGGGACGCCATGGTTACGGCAATGACAGCCGCTTCTGCTCTCTGGATG
AGGGGTGTTGCTGTTCGGGTCGACAAGATTAATGACTTGGACGGGGCCTCTCGGCCCGCCACTGTCCTCACCGAT
ATGCCGTCCTACAGCTGGAATCACTCCGTCTCGTACTGGCACGAGACGTGGGGCTCACGAAACCGCCGCTGGCCA
TCGGCTCCCAAGCACGATCTGATCGGCTGGCGGCTCCCTGCGTGCAACCCGCTGGAGCCCGTGTGGAAGAATTAC
CTGCGCGTCGGCGAGATTCCCTGGCTCAAGGATCACCAGGTGCACGGCGACGTCGTGTTTCCCGCCGCCGGCGTC
ATCAGCGCCGTCATCGAGGCCATGCGCCAATTTGAAAGCGGCCACGACATTACGAGCTTCGAGCTCCGCGAGTTC
TACATCCCCCGGCCCCTCCTCATCCCCAGCACCGAGCTCGGCGCTGAGACCTTCCTTCACCTCAAGCGCAGAAAG
ACGGGCATGGGCAGCGGGGCCGGCCCCTGGCTCGAATTCTCCTTTTACTCGCGTCAGGACGACGACACCTTCGTC
GAGCACGCCCATGGCCTCGTCCAGGCTCACTTTGCGAAGCAGTCAAATGAGGTGGACGGGGGCAGGGAGCTGAGG
GAGGAGACGTTGGCCCACCAGAGACGCTTTCAGCACCAGGTCAAAACGTGCGACGAGCCGCTCACCAGCCAAGCT
CACTACGATTTTTGCAGAAGCATAGGCCTCGTTTACGGCGACAACTTCCAGGGCCTGTGCAATGTGCGGCTCAAA
GACACCAACGTCGCCTTTGAGGTTTCCGTCGTCGACACCCCGGCCTGCATGCCGGGAGCGTGGGAGTCGGATTAC
CTCGTTCACCCGACGACTATCGACCTCTTGTTCCAGGCCCTCCTTGCGACTCTGCCCAACATGAGGAACGCCGAG
AAGCAGGGATGGGCCCCGACGGCCGTCGGCTCGATCCGTGTCTCGACAGCTATTCGACGCGGTCCCGGCACGGTA
CTCCAGGGCTACGGCGAGCTGTCCGCCGGGGCGGCCCATCAGATGGTTGGCTTCGTCATGGCGGGCGACGGCGTC
TTCGACTCGTTCCCTGGAGTTGTCATGGACGGAATCCAAGTCTCGGCTCTAGGCACCATGCAGAACGCGTCGGTC
AACGCGTCCGAGGAGTCGAGTGTCAAGCTGTACGCGACGCCCGCCTGGAAGCCGGACCTGCTTCTTCTCGAGGGA
CGACGTCCGGCGCGACTAGCCGTGGGGGCGGCTCGGGACCACTGCGCGGCTCGGTTCAGCATCGACAGCCGCGCG
ATCGTCGACGAAATGTGCGGCGCCGCGTTGCAGGGGCTGGACGACGAGGCCATCGCTGCGCTGACCCCCCATTTG
CAACAGTATGTCGGCTGGATGCAGAAGCGCACCAGCGAGGCCAGGACGTTTGCCAGCATCACGCCCCCCATTAGC
CCGGGCTTCAGCGCCTACGACGTCAAGGTGGACGAGTACTTCAGCATCGATAAGCTCAAGAGCTTCATTGACAGG
TTTCCTGTCGACGGGCGCCTTTTGCAGCACGCCTTTGCCTGCATCGACCCCATCTTCAGCGGGGAGACGACGCCG
ATCGCGGCCCTGATGGCGAGCGACGATTTCGCCCGCTTCTACAAGGAGTCCAACGGTGCCGAGGTCATGATACCC
ATCTTCCGCAACTGGTTCGACCTCAAGGCGCACAAGAAGCCAGGCCTGCGCGTTCTCGAAGTCGGGGGCGGCACG
GGCGCTATGACGGTGCCCATTCTGGAGACGATGGGAGACACCGAGGGCGAGACGCCGCGTTTCTCGGGCTTTACC
TTCACCGACATCTCACCTGGCTGGTTTGAGGGCGCTCGGACGCTGCTGCGTCGCTGGAAGTCTCGTGTTGATTAC
AAGGTGCTCAACATTGAGGTTGATCCTGTTGAGCAAGGCTTCGAGCCTGAGTCTTATGATGTGATCGTGGCTTTC
AATGTCCTTCACGCGACGAAAAGCATAAAAACGTCGCTCGAAAACTGCCGCCGGCTGCTCAAGCCCGGAGGCAAC
CTCATCGTCGGCGAATGCACCAATCCTGACGATATGCTCAGCTTCATCTTCGGCCTCTTGCCCGGCTGGTGGGCC
GCCGAGGACGGCAGGCAGTTTGGCCCCTTGCTGAGCGAGTCCGCCTGGGACAAGACGCTCAAGGATGCTGGCTTC
TCCGGCACCGATATCGCCATGCCGGACGGCGACGATGAGGCTGGCCATCATCGGATGTCGGTCATGGTCGGTACC
AAGCCGCACGAGCAGGAGGCTCCCTCTTCGACCAGAGACGTTGTTATTCTCGTGGCCAACAATGGCATCAACGAC
GCCGGAAAAAGCCTCGCCGCCTCCGTCCGCCGTGATCTTGAGCAGCTCGAAGCCCGCGTCAACATCAAGGTGTTG
GGATCGTCCGAGATGAAGTTCGAGGGCAAGACGGTCATCTCTCTCTTGGAATACGGCGCGCCGATTCTCCAAGAG
GTCCAGGAAGCCGACTTTGAGCACATCAAGCATGTCTTGCTCCATTGCCGCGAGCTCCTCTGGGTCACACGCTCG
GATGCAGCGGACAAGGAGGGGCATCCCAGCATGCGCATCATCTCGGGCCTGCTTCACTGTCTCAAGAACGAGGAC
GCGTCTCGAAGGCTTCACGAGCTGCATCTTTGTCGGAACGTCACGGCCAGCGTCGCCGAGACCAGCGACATCATT
CTCCGCAGACTCAACAGTCTGTGGCAAGGTGAAGGAGAAGAGGCAGCGGAGCTTGTCACGGTGGAACGAGACGGC
GAATTCTGCATTCCCCGTTACGTGCCGGAAAAGACGATGAACCGCAGCCTGGCGCGCACGACCGATACTGATCTG
GAGCTACAGACAGAGAAGCTCGTGCAAGCCGGCCGGCCAATGCGGCTCAAGATCGGGCGGCCGGGGATGTTGGAT
ACGCTTCATTTTGGCGACGATGATGAGGCCTTGCAGCCGCTGGCCGAAGACGAGGTCATGATTGAGGTGTTGGCG
TGTGGCCTCAACTTCCGGGACGTCTTGATCGCCATGGGCGAGCTCCGGTCGCCGAATCTGGGCTACGAGGCAGCC
GGAATCATCATCGGCACCGGGGCCAAAGTGACGCGGCTGTCGGTCGGCGATCGGGTCCTGTGCCTGAGGCCGGCC
GTGATGCGCACGCGGATCCGCACCAACCAGTGGCACGTCCATCTGCTACCGGCCTGCTTGTCGATTGAGAACGGC
GTGACGATTCCGGTGGCGTACGCGACTGCGTACCGATGTCTTGTCGAGGTGGCGAGGCTGGAAAAGGGGGAGACG
GTTCTGATTCACGCGGCAGCGGGAGGCTTCGGGCAGGCTTCGATTCACATGGCCAAGATGCTAGGTGCCGACATC
TTCTGTACGGTCAGCACCGAGGCTAAGAAGCGGCTGGTCGTCTCGCTCGGAGTCAAGCCCGAGCACGTCTTTAGC
TCGCGTGATGTCTCGTTCGAGGCGGGCATTAAGAGGGTCACTAACGGCCGTGGCGTCGACGTCGTCGTCAATTCG
CTTGCGGGCGAGCTGCTACGCCGGAGTTGGGCCTGTATGGCTCCCTACGGCCGCTTCGTCGAGGTCGGCAAACGG
GACATCGTGGGCAACAGCGGGCTAGACATGCAGCCGTTCGATAACAACGCCGTATTCGCGTGCGTTAACCTCGAT
GCCATGACGTCGGAGCCGCGGCGGCTATGGGAGCTGGTGGACAAGGTGCTTCGCTTGTTCGAGCAGGGCTCTCTA
GGACTGATCCAGCCCATTGCCGTTCACGACTTCTCCGACCTCGAAGCCGTCTTCCGCGAGATGCAGCGAGGAGCG
CACATGGGCAAGCTGGCCCTGCGCGTGACACCCGAGTCGCGGGTTCCGGTTGCGCCGCGCAAGACGGTGCCCCTG
AAGCTGTCGCCGGATGCGACATACCTGCTGGCCGGCGGCCTCGGTGGACTTGGCCGGGCCCAGGCTCTGTTTATG
GTCGAACACGGGGCCCGGCACTTGGCCTTTGTGTCGCGGTCCGGCGACTCGCGGCCCGAGGCCCGGAAGCTGCTG
GACACGCTGGCGAAGGCCGGGGTCAAGACCCGCGCCTACGCCGGCGACGTGGCCGACCGCGACGGGCTAGAGGCC
ATCCTCGACGACGTGGCGCGCCGCATGCCGCCTATCCGCGGAGTCATTCAGGGCGCCATGGTGCTCGACGACGCC
CTCTTCCAGAACATGTCATACGACCAGTGGCAGAAGGCGACGCGGCCCAAGATCCAGGGCAGCTGGAACCTTCAC
GAGTTGCTGCCGGCCGATCTCGACTTCTTCGTCGTCCTCTCCTCCATGGCTGGGGCCATCGGCTTCGTCTCCCAG
GCCAACTACGCGGCCGGCAACACGTTCCAGGACGCGCTGGCTCATTACCGGCACGCCCAAGGTCTGCCAGCATTG
AGCATCGACCTCGGCATCACAAAGGGCTTTGGTTACGTGGCCGAGCACGAAGAGGTGGCGGCCAAGCTAAAGCCG
TACGGACTGGCGACGGTTAACGAGCAGCAGCTATTTCACCTACTACGATGTGCAATGGCCGGCACCGCCGACGGC
GACAAGAAGCTGCCTACGCGGCAGCTGCTCGCCGGGGCCGGTACGGGGGGGTTGGCTCAGGCGTCACTCGCGACG
GTGCCCGAGACGAACCTGTTCTGGCTATCGGCCCTGGCGTCCTTCTCTTACCTTGGTGAGGTGGACATGAGGGCC
TCGGCCGAGATGGCAGGCGAGGAGATGACGGACGACGCGCGGCTCGTCGACCGGCTATCAGCGTCCAAGACGATG
GACGAGGCTGCCGAGGTGGTGCAGGATATGCTGCTTGCGCGCATCTCGACCATCATGTCGCTGCCGACGGCTGAC
ATCGATACGGCCAAGCCGGTTCACGCGTACGGCGTCGACAGCCTGGTGGCCGTTGAGCTAAGAAACTGGCTGTCG
AAGCGGCTGCGCAGCGACGTCAGCATCTTTGACCTGACGGGCAACATGGCCATTACGACGCTGAGCCGGAAGATT
GCTAGTCGGTCGCGCCTGGTTCCCACTGCAGCCAAGGGGCAGGGCGGCAACGAGACTGGTGCTGAGTGA
Gene >Ophcf2|00026
ATGGCTCCTGTTGACATCGCCATCGTCGGGCTCGCGTGCCGCTTTCCCGGTGAGGCCAAGTCTCCAAAGGCCTTT
TACCAGATGCTGGTGCAAGGCCGCGATGCTTGGTCCAAAGTGCCCAAATCACGATACGATGTCGACGCGTACCGT
CACCCGTCGCGTGAGCGTCGCGGGACAATGGTGAGAACAAACGGACGCGAGGCGAGCCCATGGCCGGTAGAAGCT
GACAGGTCTTGAACAGGTTTGCGAAGGCGGCTACTTTTTAGAAGACGACGTCTCTCGATGGGACGCGCCCTTCTT
CGCCTGCTCGACCGTCGAGGCGAATGCCATGGATCCGCAGCAGAGGCTTCTACTCGAAGTCGCCTACGAGAGCCT
GGAGAACGCGGGCATCCCGATGGAGGCTTTGGCCGAGAGTGACGCGGCCTGCTTCGTCGGCGGCTTCACCAACGA
CTACCAGCGCATCGTGACGAGCGAGTCGGAGGCGACGCCACAGTATACCATGACGGGCAATTCGACGGCCATGAT
GGCCAACCGTGTCAGCTGGTTCCTCAACCTACGCGGGCCGTCGGTGACGGTCGACACGGCCTGCTCCAGCTCCAT
GGCGGCGTTTCATCTGGCTTGCGAGACGATTCGGTCCGAGTCCAACGAAACGCGGTGCGCCATGGTCGGCGGCAC
CAGCCTGCTGTTCAACCCGGACGATCCATGCGGTATGAATGCGCTGGGCTTCCTGAGCCCGGATAGCCGATGCTA
TAGCTTCGACTCGCGGGCCAACGGCTACGCGCGTGGTGAGGGCGTCGCGATGCTGGTGCTCAAGCACATAGATGA
CGCATTGCGAGACGGAGACGCCATTCGGGGCGTGGTGCGTGCATCAGCGCTGAATTCAGACGGACGGGTAAGTCT
CAAGATTGATAATGATGTGGGCGACGTCGGTGGTTAAGCAGATATGATAAGGGCTTGCTGACATGATATCAAAAC
ACTAAGACGGCCGGCATCGTCCTCCCAAACGGAGAGGCTCATCAGCGCCTCATCAATCACACCTATCGCCTCGCG
GGCTTCCATCCGGCCGATACGCAGTATGCCGAGCTTCACGGCACCGGCACTCGCGTCGGCGATCCCACCGAGATC
AGCGCCGTGGCCCGGACCCTCGCCGCCGATCGATCCACGCCGTTGCTATGTGGCTCCGTCAAGACGCAGATTGGT
CACTCCGAGGCGGCCGCCGCCATGGCCGGCATCCTCAAATGCGTCCTCTCCATGGAGGCTGGCATCCTACCGCCG
AACAAGAACTTTATCGAGCCAAACCCGCGGCTCCGGCTCGAGGCCTCCAACATCGTGGTGCCAACCGAGTCGCAG
CCGTGGCCTTTAACCGCCGTCCGCCGCTGCTCTATCAATAGCTTCGGTTTCGGCGGGCTCAACGGTCACATCATC
CTCGACGGCGCCGCTGGCTACCTCGGCAGCCGCGGGCTCGCCGTTCCAGACGTCGATGCCGACGCCGAAGCAGAA
GCCCGGCCCCGACTCTTCCTCCTCTCCGCTCCGGAACAGAGCGCCGTGGCCCGCCAGCTCCGCGCTCACGCCGAC
TACCTGACCGCCTCCTCGCCGCCCGTCTCTCTGCCGCTCCTCGCTCACACGCTGGGCGCCCGCCGCTCCGTCTTC
CAGTGGCGCCTCGCCGTCGTCGCCCGCTCTGCCGACGAGCTTGAGTCCCTCTGGCGTCAGGATGGGCCGGTACCT
ATCAAGGCCGTTGCCTCGCCTGGTGTGGCTCTCGTCTTCACTGGCCAGGGCGCCCAGTGGCACGCCATGGGCCGC
GAGCTGCTGACCCTGCCCGCCTTTGCCCGCTCCGTCCGCGCCTCGGCCGCTGCGCTGGTCGCCCTGGGGTGTCCC
TGGGATGCTTGGACCGAGCTCACGCGTCCGGAAACCGAGTCGCGCGTTGGACAGGCCGTCTACTCCCAGCCGTTG
ACGTCGCTACTTCAGATTGCCCTCGTCGACCTCCTCCGGTACTGGGGTGTCACGCCGGCCGCCGTCGTTGGCCAT
TCGTCGGGTGAGATGGCGGCCGCTTATGCCGTCGGCGCCCTATCCCGCGAGGACTGCCTTGCCATCGCCTATCAC
CGCGGTCTGGTATCTGAAATGGCAGCTCAACGCGAGCCCGGCGGCGCCATGATGGCCGTCGGTCTGTCTGCCGAC
GAGATCAGGCCGCGACTGGTCAGCTCCGACATCACCGTAGCTTGCATCAACAGTCCCAATAACGTGACGCTGGCG
GGTGACGCCGCGGCTCTAGAGAAGCTCGCCGAGTCTCTGAAGCGCGACGACGTCTTCTGCCGCATTCTCAAGGTT
CAGAACGCATTTCACAGTCCGCAGATGCAGACTGTGGCCGAGGAGTACCGTCGACGTATCGCCGGCGTCAAGCCC
GTCGACGTTACGGCCGTCTTTCACTCCACCGTTCACGGCTGCCGGATCCCCACGTCGAAGCTGACGGCCGACTAC
TGGGTGGCTAATCTCTGCTCTCCTGTCGAGCTCGTCCGGGCCCTGGACGACATGCTGTGCACCAAAGAAGGCAAG
GGTAAGAGATCCAAAGCACCCACTATCATAGTTGAAGTCGGGCCACACGGCGTCCTCGCCGGCCCCTTCGAGCAG
TTTCGGCTCGCTCGCCGCGGCCTCGAGCACCTCGGCTACTACAGTCTTCTCTCACGGGGACGGGACGCCATGGTT
ACGGCAATGACAGCCGCTTCTGCTCTCTGGATGAGGGGTGTTGCTGTTCGGGTCGACAAGGTGAGACTCGGCATC
TTTTACCCTGCGGCAGAGAGCCAGCCACCTTGCTAACACGCCCGCTTGCAGATTAATGACTTGGACGGGGCCTCT
CGGCCCGCCACTGTCCTCACCGATATGCCGTCCTACAGCTGGAATCACTCCGTCTCGTACTGGCACGAGACGTGG
GGCTCACGAAACCGCCGCTGGCCATCGGCTCCCAAGCACGATCTGATCGGCTGGCGGCTCCCTGCGTGCAACCCG
CTGGAGCCCGTGTGGAAGAATTACCTGCGCGTCGGCGAGATTCCCTGGCTCAAGGATCACCAGGTGCACGGCGAC
GTCGTGTTTCCCGCCGCCGGCGTCATCAGCGCCGTCATCGAGGCCATGCGCCAATTTGAAAGCGGCCACGACATT
ACGAGCTTCGAGCTCCGCGAGTTCTACATCCCCCGGCCCCTCCTCATCCCCAGCACCGAGCTCGGCGCTGAGACC
TTCCTTCACCTCAAGCGCAGAAAGACGGGCATGGGCAGCGGGGCCGGCCCCTGGCTCGAATTCTCCTTTTACTCG
CGTCAGGACGACGACACCTTCGTCGAGCACGCCCATGGCCTCGTCCAGGCTCACTTTGCGAAGCAGTCAAATGAG
GTGGACGGGGGCAGGGAGCTGAGGGAGGAGACGTTGGCCCACCAGAGACGCTTTCAGCACCAGGTCAAAACGTGC
GACGAGCCGCTCACCAGCCAAGCTCACTACGATTTTTGCAGAAGCATAGGCCTCGTTTACGGTATGTACAGTTGT
CTGGCCGCTATGCTGTGTGCTTGAATTGCTGAACGGTGGACAGGCGACAACTTCCAGGGCCTGTGCAATGTGCGG
CTCAAAGACACCAACGTCGCCTTTGAGGTTTCCGTCGTCGACACCCCGGCCTGCATGCCGGGAGCGTGGGAGTCG
GATTACCTCGTTCACCCGACGACTATCGACCTCTTGTTCCAGGCCCTCCTTGCGACTCTGCCCAACATGAGGAAC
GCCGAGAAGCAGGGATGGGCCCCGACGGCCGTCGGCTCGATCCGTGTCTCGACAGCTATTCGACGCGGTCCCGGC
ACGGTACTCCAGGGCTACGGCGAGCTGTCCGCCGGGGCGGCCCATCAGATGGTTGGCTTCGTCATGGCGGGCGAC
GGCGTCTTCGACTCGTTCCCTGGAGTTGTCATGGACGGAATCCAAGTCTCGGCTCTAGGCACCATGCAGAACGCG
TCGGTCAACGCGTCCGAGGAGTCGAGTGTCAAGCTGTACGCGACGCCCGCCTGGAAGCCGGACCTGCTTCTTCTC
GAGGGACGACGTCCGGCGCGACTAGCCGTGGGGGCGGCTCGGGACCACTGCGCGGCTCGGTTCAGCATCGACAGC
CGCGCGATCGTCGACGAAATGTGCGGCGCCGCGTTGCAGGGGCTGGACGACGAGGCCATCGCTGCGCTGACCCCC
CATTTGCAACAGTATGTCGGCTGGATGCAGAAGCGCACCAGCGAGGCCAGGACGTTTGCCAGCATCACGCCCCCC
ATTAGCCCGGGCTTCAGCGCCTACGACGTCAAGGTGGACGAGTACTTCAGCATCGATAAGCTCAAGAGCTTCATT
GACAGGTTTCCTGTCGACGGGCGCCTTTTGCAGCACGCCTTTGCCTGCATCGACCCCATCTTCAGCGGGGAGACG
ACGCCGATCGCGGCCCTGATGGCGAGCGACGATTTCGCCCGCTTCTACAAGGAGTCCAACGGTGCCGAGGTCATG
ATACCCATCTTCCGCAACTGGTTCGACCTCAAGGCGCACAAGAAGCCAGGCCTGCGCGTTCTCGAAGTCGGGGGC
GGCACGGGCGCTATGACGGTGCCCATTCTGGAGACGATGGGAGACACCGAGGGCGAGACGCCGCGTTTCTCGGGC
TTTACCTTCACCGACATCTCACCTGGCTGGTTTGAGGGCGCTCGGACGCTGCTGCGTCGCTGGAAGTCTCGTGTT
GATTACAAGGTGCTCAACATTGAGGTTGATCCTGTTGAGCAAGGCTTCGAGCCTGAGTCTTATGATGTGATCGTG
GCTTTCAATGTACGAAGCCCATTCTCTTGCCTACGTTCTTTTTATTTTTCTTATTCTTCCGCCTCCCTTTGCCTC
TCTTTCTGACATCTTCTCGTCCATCTATAGGTCCTTCACGCGACGAAAAGCATAAAAACGTCGCTCGAAAACTGC
CGCCGGCTGCTCAAGCCCGGAGGCAACCTCATCGTCGGCGAATGCACCAATCCTGACGATATGCTCAGCTTCATC
TTCGGCCTCTTGCCCGGCTGGTGGGCCGCCGAGGACGGCAGGCAGTTTGGCCCCTTGCTGAGCGAGTCCGCCTGG
GACAAGACGCTCAAGGATGCTGGCTTCTCCGGCACCGATATCGCCATGCCGGACGGCGACGATGAGGCTGGCCAT
CATCGGATGTCGGTCATGGTCGGTACCAAGCCGCACGAGCAGGAGGCTCCCTCTTCGACCAGAGACGTTGTTATT
CTCGTGGCCAACAATGGCATCAACGACGCCGGAAAAAGCCTCGCCGCCTCCGTCCGCCGTGATCTTGAGCAGCTC
GAAGCCCGCGTCAACATCAAGGTGTTGGGATCGTCCGAGATGAAGTTCGAGGGCAAGACGGTCATCTCTCTCTTG
GAATACGGCGCGCCGATTCTCCAAGAGGTCCAGGAAGCCGACTTTGAGCACATCAAGCATGTCTTGCTCCATTGC
CGCGAGCTCCTCTGGGTCACACGCTCGGATGCAGCGGACAAGGAGGGGCATCCCAGCATGCGCATCATCTCGGGC
CTGCTTCACTGTCTCAAGAACGAGGACGCGTCTCGAAGGCTTCACGAGCTGCATCTTTGTCGGAACGTCACGGCC
AGCGTCGCCGAGACCAGCGACATCATTCTCCGCAGACTCAACAGTCTGTGGCAAGGTGAAGGAGAAGAGGCAGCG
GAGCTTGTCACGGTGGAACGAGACGGCGAATTCTGCATTCCCCGTTACGTGCCGGAAAAGACGATGAACCGCAGC
CTGGCGCGCACGACCGATACTGATCTGGAGCTACAGACAGAGAAGCTCGTGCAAGCCGGCCGGCCAATGCGGCTC
AAGATCGGGCGGCCGGGGATGTTGGATACGCTTCATTTTGGCGACGATGATGAGGCCTTGCAGCCGCTGGCCGAA
GACGAGGTCATGATTGAGGTGTTGGCGTGTGGCCTCAACTTCCGGCAGGTTAATAGGCGCCTAGGGGCAAGACAT
GTTGCTAACGAAGCATGTTCAGGGACGTCTTGATCGCCATGGGCGAGCTCCGGTCGCCGAATCTGGGCTACGAGG
CAGCCGGAATCATCATCGGCACCGGGGCCAAAGTGACGCGGCTGTCGGTCGGCGATCGGGTCCTGTGCCTGAGGC
CGGCCGTGATGCGCACGCGGATCCGCACCAACCAGTGGCACGTCCATCTGCTACCGGCCTGCTTGTCGATTGAGA
ACGGCGTGACGATTCCGGTGGCGTACGCGACTGCGTACCGATGTCTTGTCGAGGTGGCGAGGCTGGAAAAGGGGG
AGACGGTTCTGATTCACGCGGCAGCGGGAGGTGAGTAGGCTCCGTGATGATCGCAATAGGAGCTTCTTTGATTAA
CGGGTATTCTTTCTCCAGGCTTCGGGCAGGCTTCGATTCACATGGCCAAGATGCTAGGTGCCGACATCTTCTGTA
CGGTCAGCACCGAGGCTAAGAAGCGGCTGGTCGTCTCGCTCGGAGTCAAGCCCGAGCACGTCTTTAGCTCGCGTG
ATGTCTCGTTCGAGGCGGGCATTAAGAGGGTCACTAACGGCCGTGGCGTCGACGTCGTCGTCAATTCGCTTGCGG
GCGAGCTGCTACGCCGGAGTTGGGCCTGTATGGCTCCCTACGGCCGCTTCGTCGAGGTCGGCAAACGGGACATCG
TGGGCAACAGCGGGCTAGACATGCAGCCGTTCGATAACAACGCCGTATTCGCGTGCGTTAACCTCGATGCCATGA
CGTCGGAGCCGCGGCGGCTATGGGAGCTGGTGGACAAGGTGCTTCGCTTGTTCGAGCAGGGCTCTCTAGGACTGA
TCCAGCCCATTGCCGTTCACGACTTCTCCGACCTCGAAGCCGTCTTCCGCGAGATGCAGCGAGGAGCGCACATGG
GCAAGCTGGCCCTGCGCGTGACACCCGAGTCGCGGGTTCCGGTTGCGCCGCGCAAGACGGTGCCCCTGAAGCTGT
CGCCGGATGCGACATACCTGCTGGCCGGCGGCCTCGGTGGACTTGGCCGGGCCCAGGCTCTGTTTATGGTCGAAC
ACGGGGCCCGGCACTTGGCCTTTGTGTCGCGGTCCGGCGACTCGCGGCCCGAGGCCCGGAAGCTGCTGGACACGC
TGGCGAAGGCCGGGGTCAAGACCCGCGCCTACGCCGGCGACGTGGCCGACCGCGACGGGCTAGAGGCCATCCTCG
ACGACGTGGCGCGCCGCATGCCGCCTATCCGCGGAGTCATTCAGGGCGCCATGGTGCTCGACGACGCCCTCTTCC
AGAACATGTCATACGACCAGTGGCAGAAGGCGACGCGGCCCAAGATCCAGGGCAGCTGGAACCTTCACGAGTTGC
TGCCGGCCGATCTCGACTTCTTCGTCGTCCTCTCCTCCATGGCTGGGGCCATCGGCTTCGTCTCCCAGGCCAACT
ACGCGGCCGGCAACACGTTCCAGGACGCGCTGGCTCATTACCGGCACGCCCAAGGTCTGCCAGCATTGAGCATCG
ACCTCGGCATCACAAAGGGCTTTGGTTACGTGGCCGAGCACGAAGAGGTGGCGGCCAAGCTAAAGCCGTACGGAC
TGGCGACGGTTAACGAGCAGCAGCTATTTCACCTACTACGATGTGCAATGGCCGGCACCGCCGACGGCGACAAGA
AGCTGCCTACGCGGCAGCTGCTCGCCGGGGCCGGTACGGGGGGGTTGGCTCAGGCGTCACTCGCGACGGTGCCCG
AGACGAACCTGTTCTGGCTATCGGCCCTGGCGTCCTTCTCTTACCTTGGTGAGGTGGACATGAGGGCCTCGGCCG
AGATGGCAGGCGAGGAGATGACGGACGACGCGCGGCTCGTCGACCGGCTATCAGCGTCCAAGACGATGGACGAGG
CTGCCGAGGTGGTGCAGGATATGCTGCTTGCGCGCATCTCGACCATCATGTCGCTGCCGACGGCTGACATCGATA
CGGCCAAGCCGGTTCACGCGTACGGCGTCGACAGCCTGGTGGCCGTTGAGCTAAGAAACTGGCTGTCGAAGCGGC
TGCGCAGCGACGTCAGCATCTTTGACCTGACGGGCAACATGGCCATTACGACGCTGAGCCGGAAGATTGCTAGTC
GGTCGCGCCTGGTTCCCACTGCAGCCAAGGGGCAGGGCGGCAACGAGACTGGTGCTGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail