Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00020
Gene name
Locationscaffold_01:60778..62020
Strand-
Gene length (bp)1242
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 4.5E-26 75 372

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1788 0.1697 0.852 0.1779 0.1885 0.0598 0.2402 0.1535 0.1417 0.0117

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999639

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup811
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5089
Ophiocordyceps australis map64 (Brazil) OphauB2|144
Ophiocordyceps australis map64 (Brazil) OphauB2|2380
Ophiocordyceps camponoti-floridani Ophcf2|00020 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2813
Ophiocordyceps kimflemingae Ophio5|4078
Ophiocordyceps subramaniannii Hirsu2|3739
Ophiocordyceps subramaniannii Hirsu2|6049

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00020
MQTRMIHAALLLLWTRQVTQAKTFTIKDITVVDVKAGDLLARKNIVVEDNKILSIDDAKNSTRHTDGDINGRGKF
AIPGLSDMHVHVFFSNDPASFEVGNNLTMPLFVANGVTTVRDLGSNLKAIKSARDDVEQHKLVGPRVFFTGPMLD
GPNSPFETTIRLATPAEARREVKNLKDSGVDYIKVHLKLSRSVFDEVARACKAENITFGGHVPDSITAQHAVNMG
MGFIEHMSRLDDIDSDGDLKETMRDKEIWQCPTLKLGPAARRFNLTKTLFDAKVPMVAGTDSPAGQNLCPGFSLL
DELQLMNEAGLSELETLQTATVNASSSLGSKGLMMGTIEVGKLADIVLLDENPLDDIRNVRSISTVIADGRVFSK
KEIDKMLTGADRLSQCVEQRGTRAARDLVSAGPSCCSA*
Coding >Ophcf2|00020
ATGCAGACACGCATGATCCACGCAGCTTTGTTGCTGTTGTGGACAAGACAAGTCACTCAGGCAAAGACTTTTACC
ATCAAAGACATCACCGTTGTCGATGTCAAGGCTGGAGACCTGTTAGCCCGAAAAAACATCGTTGTCGAGGACAAT
AAAATCCTGAGTATAGACGACGCAAAGAACTCCACGAGACACACAGATGGCGATATCAATGGCCGAGGCAAGTTT
GCCATTCCAGGTCTCAGCGACATGCACGTTCATGTCTTCTTCAGCAACGATCCGGCATCTTTTGAAGTCGGGAAT
AACCTGACCATGCCTCTCTTCGTCGCCAACGGCGTGACAACCGTTCGCGATCTTGGCAGTAATTTGAAGGCCATC
AAGTCTGCCCGTGATGACGTCGAACAGCACAAGCTCGTCGGGCCGCGCGTCTTCTTCACAGGCCCGATGCTGGAC
GGCCCAAACTCGCCGTTTGAAACGACCATCAGACTCGCGACCCCAGCGGAGGCGCGACGGGAGGTCAAGAACCTC
AAGGACAGCGGCGTCGACTACATCAAGGTGCACTTGAAGCTATCCAGATCAGTATTCGATGAGGTGGCACGAGCG
TGTAAAGCCGAGAACATTACCTTTGGCGGTCATGTCCCGGACTCTATAACGGCCCAGCACGCGGTCAACATGGGC
ATGGGCTTCATCGAGCACATGAGCCGCCTCGACGATATCGACAGTGACGGCGACCTCAAAGAGACGATGCGGGAC
AAGGAGATTTGGCAGTGCCCTACCCTCAAGCTCGGTCCAGCTGCCCGACGGTTCAACCTCACCAAGACTCTGTTC
GACGCAAAGGTCCCCATGGTCGCCGGCACAGACTCTCCGGCCGGTCAGAATCTGTGTCCAGGCTTCAGTCTTCTC
GACGAGCTCCAGCTGATGAACGAAGCTGGTCTCAGCGAGCTGGAGACACTGCAGACGGCCACGGTCAACGCCTCC
TCCTCACTGGGGTCCAAGGGGCTAATGATGGGAACCATCGAAGTTGGAAAGCTGGCGGATATTGTCTTGCTAGAC
GAGAACCCGCTTGACGATATTCGCAATGTGCGCAGCATCAGTACCGTCATCGCTGATGGACGAGTCTTTTCGAAG
AAGGAGATTGATAAGATGCTTACGGGGGCCGATCGACTCAGCCAGTGTGTTGAACAGCGTGGCACCAGGGCTGCG
AGAGACCTGGTGAGTGCTGGTCCGTCGTGTTGTTCTGCGTAG
Transcript >Ophcf2|00020
ATGCAGACACGCATGATCCACGCAGCTTTGTTGCTGTTGTGGACAAGACAAGTCACTCAGGCAAAGACTTTTACC
ATCAAAGACATCACCGTTGTCGATGTCAAGGCTGGAGACCTGTTAGCCCGAAAAAACATCGTTGTCGAGGACAAT
AAAATCCTGAGTATAGACGACGCAAAGAACTCCACGAGACACACAGATGGCGATATCAATGGCCGAGGCAAGTTT
GCCATTCCAGGTCTCAGCGACATGCACGTTCATGTCTTCTTCAGCAACGATCCGGCATCTTTTGAAGTCGGGAAT
AACCTGACCATGCCTCTCTTCGTCGCCAACGGCGTGACAACCGTTCGCGATCTTGGCAGTAATTTGAAGGCCATC
AAGTCTGCCCGTGATGACGTCGAACAGCACAAGCTCGTCGGGCCGCGCGTCTTCTTCACAGGCCCGATGCTGGAC
GGCCCAAACTCGCCGTTTGAAACGACCATCAGACTCGCGACCCCAGCGGAGGCGCGACGGGAGGTCAAGAACCTC
AAGGACAGCGGCGTCGACTACATCAAGGTGCACTTGAAGCTATCCAGATCAGTATTCGATGAGGTGGCACGAGCG
TGTAAAGCCGAGAACATTACCTTTGGCGGTCATGTCCCGGACTCTATAACGGCCCAGCACGCGGTCAACATGGGC
ATGGGCTTCATCGAGCACATGAGCCGCCTCGACGATATCGACAGTGACGGCGACCTCAAAGAGACGATGCGGGAC
AAGGAGATTTGGCAGTGCCCTACCCTCAAGCTCGGTCCAGCTGCCCGACGGTTCAACCTCACCAAGACTCTGTTC
GACGCAAAGGTCCCCATGGTCGCCGGCACAGACTCTCCGGCCGGTCAGAATCTGTGTCCAGGCTTCAGTCTTCTC
GACGAGCTCCAGCTGATGAACGAAGCTGGTCTCAGCGAGCTGGAGACACTGCAGACGGCCACGGTCAACGCCTCC
TCCTCACTGGGGTCCAAGGGGCTAATGATGGGAACCATCGAAGTTGGAAAGCTGGCGGATATTGTCTTGCTAGAC
GAGAACCCGCTTGACGATATTCGCAATGTGCGCAGCATCAGTACCGTCATCGCTGATGGACGAGTCTTTTCGAAG
AAGGAGATTGATAAGATGCTTACGGGGGCCGATCGACTCAGCCAGTGTGTTGAACAGCGTGGCACCAGGGCTGCG
AGAGACCTGGTGAGTGCTGGTCCGTCGTGTTGTTCTGCGTAG
Gene >Ophcf2|00020
ATGCAGACACGCATGATCCACGCAGCTTTGTTGCTGTTGTGGACAAGACAAGTCACTCAGGCAAAGACTTTTACC
ATCAAAGACATCACCGTTGTCGATGTCAAGGCTGGAGACCTGTTAGCCCGAAAAAACATCGTTGTCGAGGACAAT
AAAATCCTGAGTATAGACGACGCAAAGAACTCCACGAGACACACAGATGGCGATATCAATGGCCGAGGCAAGTTT
GCCATTCCAGGTCTCAGCGACATGCACGTTCATGTCTTCTTCAGCAACGATCCGGCATCTTTTGAAGTCGGGAAT
AACCTGACCATGCCTCTCTTCGTCGCCAACGGCGTGACAACCGTTCGCGATCTTGGCAGTAATTTGAAGGCCATC
AAGTCTGCCCGTGATGACGTCGAACAGCACAAGCTCGTCGGGCCGCGCGTCTTCTTCACAGGCCCGATGCTGGAC
GGCCCAAACTCGCCGTTTGAAACGACCATCAGACTCGCGACCCCAGCGGAGGCGCGACGGGAGGTCAAGAACCTC
AAGGACAGCGGCGTCGACTACATCAAGGTGCACTTGAAGCTATCCAGATCAGTATTCGATGAGGTGGCACGAGCG
TGTAAAGCCGAGAACATTACCTTTGGCGGTCATGTCCCGGACTCTATAACGGCCCAGCACGCGGTCAACATGGGC
ATGGGCTTCATCGAGCACATGAGCCGCCTCGACGATATCGACAGTGACGGCGACCTCAAAGAGACGATGCGGGAC
AAGGAGATTTGGCAGTGCCCTACCCTCAAGCTCGGTCCAGCTGCCCGACGGTTCAACCTCACCAAGACTCTGTTC
GACGCAAAGGTCCCCATGGTCGCCGGCACAGACTCTCCGGCCGGTCAGAATCTGTGTCCAGGCTTCAGTCTTCTC
GACGAGCTCCAGCTGATGAACGAAGCTGGTCTCAGCGAGCTGGAGACACTGCAGACGGCCACGGTCAACGCCTCC
TCCTCACTGGGGTCCAAGGGGCTAATGATGGGAACCATCGAAGTTGGAAAGCTGGCGGATATTGTCTTGCTAGAC
GAGAACCCGCTTGACGATATTCGCAATGTGCGCAGCATCAGTACCGTCATCGCTGATGGACGAGTCTTTTCGAAG
AAGGAGATTGATAAGATGCTTACGGGGGCCGATCGACTCAGCCAGTGTGTTGAACAGCGTGGCACCAGGGCTGCG
AGAGACCTGGTGAGTGCTGGTCCGTCGTGTTGTTCTGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail