Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00014
Gene name
Locationscaffold_01:43933..46756
Strand-
Gene length (bp)2823
Transcript length (bp)2823
Coding sequence length (bp)2823
Protein length (aa) 941

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 2.4E-17 453 769

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 36 55 19
2 65 87 22
3 103 125 22
4 145 167 22
5 253 275 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 143.44 70.73 216.15
Alive In ants, during behavior modification 18.42 8.97 27.88
Dead In ants, recently dead 17.89 9.48 26.30

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.905173 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00014
MAVVSSTSPARLFFRFLGHRLLLLFSTLTRFADRRFALALAASGLVSSKLVHVYAHADALPLRALLLWGPSLFGQ
DTVLLLVLRLLLDNGLLPAPVRASASAVAVSVCVLVAAMASIIVSFFAVAGLELHWRNVGAAFDLSALRMLLTGL
LSMGLVMAALLLLAGILQTPCFLVTGMALDLLQWLLNALLPASIRSWVSCSGSGSGSGSEYRHLTSRRDSECDYE
DEDDEKYTDTDAASSLDLRSEPASSRRLLVIVYILVGFSLLAQTVTYIFRPSDASLIFVSWTLPLLPLVELTLSS
SVLTRMRGGGGFQGLDEDVTALSSPPPPFSWLPVDGKKLAGFEDWYIPDRTHYDATRDPIRVTNLHQAPLPEIRT
ALGRLRIRHVVLLELETIRKDVFPLKKDGLIWRKLANGTDSGKLSAEAVQLLSTLTPTANFVTGEYDDGFKHQGR
PKRGGLNFVNAHTSSTYTLKSLTATLCGLTPLLTDFNQEYRNHVYQPCLPHVFEALNRLDGVEKKGGEQMRAAGS
VDEGYEEDWDDEEEGEEEGEREEQQQQQQPADNSSFTSFPWRPTFMQSTTSTFDKQTPLMKAFGFRPDSIIDKEY
LRSNRAKFGPSKVMDNNYFSMPEVTLEEYVRDAFSSARRNKERVFLSHLTSTTHHDWKLPANETYVPLTDDSELS
PLSHFVNCVGYGDRWVRRVLDIIREEGAEDETLVILQGDHGLSNAEIGSVSSYGTGHVGNFHVPLVLSHPHLPPI
DISDAVSSIQVLPTILDLLAESNSLSPSQTTAARDLAANYEGQSLIRPQLDGPSDTGLGAWQFSLVNPGGTMIAV
RERGRPGFRLIVPVVDNVSWRFTDVAADEHEEKPIVAFDLEVLAADVKKRFGKGAAQWVRKAVAVTSWYVDENME
RWRYGGKRPRKGSMVTTEDSKAKQKTINSKGSKQVKRPRR*
Coding >Ophcf2|00014
ATGGCCGTCGTATCCTCCACTTCACCAGCCCGACTCTTTTTCCGCTTTCTGGGTCATCGACTGCTGCTCCTCTTT
AGCACCCTGACGCGCTTCGCAGACCGACGCTTCGCCCTGGCCTTGGCCGCCTCCGGTCTCGTCTCCTCCAAGCTG
GTTCACGTTTACGCCCACGCGGATGCCCTACCGCTGCGGGCGCTGCTGCTCTGGGGCCCCTCCCTGTTCGGGCAG
GATACCGTTCTGCTGCTGGTGCTGAGGCTGTTGCTGGACAATGGTCTTCTCCCGGCTCCGGTCCGGGCTTCGGCG
TCGGCCGTGGCCGTGTCCGTGTGCGTCCTTGTCGCCGCAATGGCCTCCATAATCGTCTCCTTCTTCGCTGTTGCC
GGGCTGGAACTTCACTGGAGGAACGTCGGGGCCGCGTTCGATCTTTCGGCGCTGAGGATGCTGTTGACGGGTCTG
TTGTCCATGGGGCTGGTCATGGCTGCGTTACTGCTGTTGGCTGGTATTCTGCAAACGCCGTGCTTCTTGGTGACG
GGCATGGCGCTGGATCTGCTGCAGTGGCTCCTCAACGCGCTGCTGCCGGCTTCGATCCGGAGTTGGGTTTCCTGC
TCCGGCTCCGGCTCCGGCTCCGGCTCCGAGTACCGGCATCTCACGTCTAGGCGGGACAGCGAATGCGACTACGAA
GACGAAGACGATGAAAAGTACACCGACACCGACGCCGCCTCCTCTCTCGATCTCCGGTCCGAGCCGGCAAGTTCT
CGCCGTTTGCTGGTGATCGTCTATATCCTCGTCGGCTTCTCGCTGCTGGCCCAGACCGTCACATACATCTTCCGT
CCGTCCGACGCCTCGCTCATCTTCGTCTCCTGGACGCTGCCGCTTCTTCCGCTGGTTGAGCTGACGCTCTCGTCA
TCCGTTCTGACCCGCATGCGAGGAGGCGGTGGCTTTCAGGGCCTCGACGAGGACGTCACGGCTCTCTCGAGCCCA
CCACCACCGTTTTCTTGGCTGCCGGTTGACGGGAAGAAGCTCGCCGGCTTCGAGGATTGGTATATTCCGGATCGG
ACGCACTACGACGCGACGCGGGATCCCATCAGGGTGACCAACCTTCATCAGGCTCCGTTGCCGGAAATTCGAACG
GCGCTGGGTCGGCTGCGGATCCGGCACGTTGTTCTCCTTGAACTGGAGACGATTCGAAAGGACGTGTTCCCCCTG
AAGAAGGATGGTCTCATCTGGCGGAAGCTCGCCAACGGGACGGACTCGGGAAAGCTATCGGCTGAGGCGGTACAG
CTGCTTTCGACGCTGACGCCGACGGCCAATTTCGTGACGGGAGAATACGACGATGGCTTCAAGCATCAGGGTCGA
CCCAAGAGGGGCGGACTCAACTTTGTCAATGCGCATACCAGCAGTACTTATACGCTCAAGAGTCTGACGGCGACC
CTGTGCGGACTGACGCCGCTGTTGACGGATTTTAACCAGGAGTACCGGAATCATGTATACCAGCCGTGTTTGCCG
CATGTGTTTGAGGCTTTAAACCGGTTGGATGGCGTTGAGAAGAAGGGAGGGGAGCAGATGAGAGCCGCCGGGTCT
GTTGATGAAGGGTATGAAGAGGATTGGGATGATGAAGAAGAGGGAGAGGAAGAAGGAGAAAGAGAAGAGCAACAA
CAACAACAACAACCCGCAGACAACAGCTCATTCACTTCCTTCCCCTGGCGCCCAACCTTTATGCAGTCAACAACC
TCAACCTTCGACAAACAAACGCCCCTAATGAAAGCCTTTGGCTTCCGACCAGACTCCATCATTGACAAGGAGTAT
CTCCGCAGCAACCGTGCCAAATTCGGCCCCAGCAAAGTGATGGATAACAACTACTTCAGCATGCCCGAGGTAACG
CTGGAAGAGTACGTCCGCGATGCCTTTTCTTCGGCACGCCGTAATAAGGAGCGCGTCTTCTTGTCTCATCTTACC
AGCACGACGCACCATGATTGGAAGCTGCCTGCCAATGAGACGTATGTGCCGTTGACGGATGACTCGGAGCTGAGC
CCTCTTTCTCATTTTGTTAACTGCGTTGGCTACGGAGATCGGTGGGTTCGGCGTGTTCTTGACATCATCCGTGAG
GAGGGTGCCGAGGACGAGACCCTCGTTATACTTCAGGGAGATCACGGGCTATCCAACGCTGAGATTGGAAGCGTC
TCCTCGTACGGAACCGGTCACGTCGGCAACTTCCACGTCCCCCTCGTCCTCTCACATCCTCACCTCCCACCCATC
GACATCTCCGACGCCGTCTCCTCCATCCAAGTACTCCCCACGATTCTCGACCTCCTCGCCGAAAGCAACTCACTC
TCCCCCTCCCAGACGACTGCAGCCCGCGACCTGGCCGCCAACTACGAAGGCCAATCTTTAATCCGCCCGCAGCTC
GACGGGCCGAGCGACACTGGTTTGGGGGCCTGGCAGTTCAGCCTCGTCAATCCGGGTGGGACGATGATTGCCGTC
CGGGAGAGAGGCCGCCCTGGTTTCCGTCTGATTGTACCTGTCGTCGATAACGTGAGCTGGCGGTTTACTGATGTT
GCGGCGGATGAGCACGAGGAGAAGCCTATTGTGGCGTTTGATCTCGAGGTCTTGGCGGCTGATGTTAAGAAAAGA
TTTGGAAAGGGAGCGGCCCAGTGGGTGAGGAAGGCGGTCGCTGTGACGAGCTGGTATGTTGACGAGAACATGGAG
AGGTGGCGATACGGCGGCAAGAGGCCGAGAAAGGGATCCATGGTGACGACCGAGGATTCCAAGGCGAAACAGAAG
ACGATCAACTCCAAGGGATCCAAGCAGGTCAAAAGGCCAAGGAGGTAA
Transcript >Ophcf2|00014
ATGGCCGTCGTATCCTCCACTTCACCAGCCCGACTCTTTTTCCGCTTTCTGGGTCATCGACTGCTGCTCCTCTTT
AGCACCCTGACGCGCTTCGCAGACCGACGCTTCGCCCTGGCCTTGGCCGCCTCCGGTCTCGTCTCCTCCAAGCTG
GTTCACGTTTACGCCCACGCGGATGCCCTACCGCTGCGGGCGCTGCTGCTCTGGGGCCCCTCCCTGTTCGGGCAG
GATACCGTTCTGCTGCTGGTGCTGAGGCTGTTGCTGGACAATGGTCTTCTCCCGGCTCCGGTCCGGGCTTCGGCG
TCGGCCGTGGCCGTGTCCGTGTGCGTCCTTGTCGCCGCAATGGCCTCCATAATCGTCTCCTTCTTCGCTGTTGCC
GGGCTGGAACTTCACTGGAGGAACGTCGGGGCCGCGTTCGATCTTTCGGCGCTGAGGATGCTGTTGACGGGTCTG
TTGTCCATGGGGCTGGTCATGGCTGCGTTACTGCTGTTGGCTGGTATTCTGCAAACGCCGTGCTTCTTGGTGACG
GGCATGGCGCTGGATCTGCTGCAGTGGCTCCTCAACGCGCTGCTGCCGGCTTCGATCCGGAGTTGGGTTTCCTGC
TCCGGCTCCGGCTCCGGCTCCGGCTCCGAGTACCGGCATCTCACGTCTAGGCGGGACAGCGAATGCGACTACGAA
GACGAAGACGATGAAAAGTACACCGACACCGACGCCGCCTCCTCTCTCGATCTCCGGTCCGAGCCGGCAAGTTCT
CGCCGTTTGCTGGTGATCGTCTATATCCTCGTCGGCTTCTCGCTGCTGGCCCAGACCGTCACATACATCTTCCGT
CCGTCCGACGCCTCGCTCATCTTCGTCTCCTGGACGCTGCCGCTTCTTCCGCTGGTTGAGCTGACGCTCTCGTCA
TCCGTTCTGACCCGCATGCGAGGAGGCGGTGGCTTTCAGGGCCTCGACGAGGACGTCACGGCTCTCTCGAGCCCA
CCACCACCGTTTTCTTGGCTGCCGGTTGACGGGAAGAAGCTCGCCGGCTTCGAGGATTGGTATATTCCGGATCGG
ACGCACTACGACGCGACGCGGGATCCCATCAGGGTGACCAACCTTCATCAGGCTCCGTTGCCGGAAATTCGAACG
GCGCTGGGTCGGCTGCGGATCCGGCACGTTGTTCTCCTTGAACTGGAGACGATTCGAAAGGACGTGTTCCCCCTG
AAGAAGGATGGTCTCATCTGGCGGAAGCTCGCCAACGGGACGGACTCGGGAAAGCTATCGGCTGAGGCGGTACAG
CTGCTTTCGACGCTGACGCCGACGGCCAATTTCGTGACGGGAGAATACGACGATGGCTTCAAGCATCAGGGTCGA
CCCAAGAGGGGCGGACTCAACTTTGTCAATGCGCATACCAGCAGTACTTATACGCTCAAGAGTCTGACGGCGACC
CTGTGCGGACTGACGCCGCTGTTGACGGATTTTAACCAGGAGTACCGGAATCATGTATACCAGCCGTGTTTGCCG
CATGTGTTTGAGGCTTTAAACCGGTTGGATGGCGTTGAGAAGAAGGGAGGGGAGCAGATGAGAGCCGCCGGGTCT
GTTGATGAAGGGTATGAAGAGGATTGGGATGATGAAGAAGAGGGAGAGGAAGAAGGAGAAAGAGAAGAGCAACAA
CAACAACAACAACCCGCAGACAACAGCTCATTCACTTCCTTCCCCTGGCGCCCAACCTTTATGCAGTCAACAACC
TCAACCTTCGACAAACAAACGCCCCTAATGAAAGCCTTTGGCTTCCGACCAGACTCCATCATTGACAAGGAGTAT
CTCCGCAGCAACCGTGCCAAATTCGGCCCCAGCAAAGTGATGGATAACAACTACTTCAGCATGCCCGAGGTAACG
CTGGAAGAGTACGTCCGCGATGCCTTTTCTTCGGCACGCCGTAATAAGGAGCGCGTCTTCTTGTCTCATCTTACC
AGCACGACGCACCATGATTGGAAGCTGCCTGCCAATGAGACGTATGTGCCGTTGACGGATGACTCGGAGCTGAGC
CCTCTTTCTCATTTTGTTAACTGCGTTGGCTACGGAGATCGGTGGGTTCGGCGTGTTCTTGACATCATCCGTGAG
GAGGGTGCCGAGGACGAGACCCTCGTTATACTTCAGGGAGATCACGGGCTATCCAACGCTGAGATTGGAAGCGTC
TCCTCGTACGGAACCGGTCACGTCGGCAACTTCCACGTCCCCCTCGTCCTCTCACATCCTCACCTCCCACCCATC
GACATCTCCGACGCCGTCTCCTCCATCCAAGTACTCCCCACGATTCTCGACCTCCTCGCCGAAAGCAACTCACTC
TCCCCCTCCCAGACGACTGCAGCCCGCGACCTGGCCGCCAACTACGAAGGCCAATCTTTAATCCGCCCGCAGCTC
GACGGGCCGAGCGACACTGGTTTGGGGGCCTGGCAGTTCAGCCTCGTCAATCCGGGTGGGACGATGATTGCCGTC
CGGGAGAGAGGCCGCCCTGGTTTCCGTCTGATTGTACCTGTCGTCGATAACGTGAGCTGGCGGTTTACTGATGTT
GCGGCGGATGAGCACGAGGAGAAGCCTATTGTGGCGTTTGATCTCGAGGTCTTGGCGGCTGATGTTAAGAAAAGA
TTTGGAAAGGGAGCGGCCCAGTGGGTGAGGAAGGCGGTCGCTGTGACGAGCTGGTATGTTGACGAGAACATGGAG
AGGTGGCGATACGGCGGCAAGAGGCCGAGAAAGGGATCCATGGTGACGACCGAGGATTCCAAGGCGAAACAGAAG
ACGATCAACTCCAAGGGATCCAAGCAGGTCAAAAGGCCAAGGAGGTAA
Gene >Ophcf2|00014
ATGGCCGTCGTATCCTCCACTTCACCAGCCCGACTCTTTTTCCGCTTTCTGGGTCATCGACTGCTGCTCCTCTTT
AGCACCCTGACGCGCTTCGCAGACCGACGCTTCGCCCTGGCCTTGGCCGCCTCCGGTCTCGTCTCCTCCAAGCTG
GTTCACGTTTACGCCCACGCGGATGCCCTACCGCTGCGGGCGCTGCTGCTCTGGGGCCCCTCCCTGTTCGGGCAG
GATACCGTTCTGCTGCTGGTGCTGAGGCTGTTGCTGGACAATGGTCTTCTCCCGGCTCCGGTCCGGGCTTCGGCG
TCGGCCGTGGCCGTGTCCGTGTGCGTCCTTGTCGCCGCAATGGCCTCCATAATCGTCTCCTTCTTCGCTGTTGCC
GGGCTGGAACTTCACTGGAGGAACGTCGGGGCCGCGTTCGATCTTTCGGCGCTGAGGATGCTGTTGACGGGTCTG
TTGTCCATGGGGCTGGTCATGGCTGCGTTACTGCTGTTGGCTGGTATTCTGCAAACGCCGTGCTTCTTGGTGACG
GGCATGGCGCTGGATCTGCTGCAGTGGCTCCTCAACGCGCTGCTGCCGGCTTCGATCCGGAGTTGGGTTTCCTGC
TCCGGCTCCGGCTCCGGCTCCGGCTCCGAGTACCGGCATCTCACGTCTAGGCGGGACAGCGAATGCGACTACGAA
GACGAAGACGATGAAAAGTACACCGACACCGACGCCGCCTCCTCTCTCGATCTCCGGTCCGAGCCGGCAAGTTCT
CGCCGTTTGCTGGTGATCGTCTATATCCTCGTCGGCTTCTCGCTGCTGGCCCAGACCGTCACATACATCTTCCGT
CCGTCCGACGCCTCGCTCATCTTCGTCTCCTGGACGCTGCCGCTTCTTCCGCTGGTTGAGCTGACGCTCTCGTCA
TCCGTTCTGACCCGCATGCGAGGAGGCGGTGGCTTTCAGGGCCTCGACGAGGACGTCACGGCTCTCTCGAGCCCA
CCACCACCGTTTTCTTGGCTGCCGGTTGACGGGAAGAAGCTCGCCGGCTTCGAGGATTGGTATATTCCGGATCGG
ACGCACTACGACGCGACGCGGGATCCCATCAGGGTGACCAACCTTCATCAGGCTCCGTTGCCGGAAATTCGAACG
GCGCTGGGTCGGCTGCGGATCCGGCACGTTGTTCTCCTTGAACTGGAGACGATTCGAAAGGACGTGTTCCCCCTG
AAGAAGGATGGTCTCATCTGGCGGAAGCTCGCCAACGGGACGGACTCGGGAAAGCTATCGGCTGAGGCGGTACAG
CTGCTTTCGACGCTGACGCCGACGGCCAATTTCGTGACGGGAGAATACGACGATGGCTTCAAGCATCAGGGTCGA
CCCAAGAGGGGCGGACTCAACTTTGTCAATGCGCATACCAGCAGTACTTATACGCTCAAGAGTCTGACGGCGACC
CTGTGCGGACTGACGCCGCTGTTGACGGATTTTAACCAGGAGTACCGGAATCATGTATACCAGCCGTGTTTGCCG
CATGTGTTTGAGGCTTTAAACCGGTTGGATGGCGTTGAGAAGAAGGGAGGGGAGCAGATGAGAGCCGCCGGGTCT
GTTGATGAAGGGTATGAAGAGGATTGGGATGATGAAGAAGAGGGAGAGGAAGAAGGAGAAAGAGAAGAGCAACAA
CAACAACAACAACCCGCAGACAACAGCTCATTCACTTCCTTCCCCTGGCGCCCAACCTTTATGCAGTCAACAACC
TCAACCTTCGACAAACAAACGCCCCTAATGAAAGCCTTTGGCTTCCGACCAGACTCCATCATTGACAAGGAGTAT
CTCCGCAGCAACCGTGCCAAATTCGGCCCCAGCAAAGTGATGGATAACAACTACTTCAGCATGCCCGAGGTAACG
CTGGAAGAGTACGTCCGCGATGCCTTTTCTTCGGCACGCCGTAATAAGGAGCGCGTCTTCTTGTCTCATCTTACC
AGCACGACGCACCATGATTGGAAGCTGCCTGCCAATGAGACGTATGTGCCGTTGACGGATGACTCGGAGCTGAGC
CCTCTTTCTCATTTTGTTAACTGCGTTGGCTACGGAGATCGGTGGGTTCGGCGTGTTCTTGACATCATCCGTGAG
GAGGGTGCCGAGGACGAGACCCTCGTTATACTTCAGGGAGATCACGGGCTATCCAACGCTGAGATTGGAAGCGTC
TCCTCGTACGGAACCGGTCACGTCGGCAACTTCCACGTCCCCCTCGTCCTCTCACATCCTCACCTCCCACCCATC
GACATCTCCGACGCCGTCTCCTCCATCCAAGTACTCCCCACGATTCTCGACCTCCTCGCCGAAAGCAACTCACTC
TCCCCCTCCCAGACGACTGCAGCCCGCGACCTGGCCGCCAACTACGAAGGCCAATCTTTAATCCGCCCGCAGCTC
GACGGGCCGAGCGACACTGGTTTGGGGGCCTGGCAGTTCAGCCTCGTCAATCCGGGTGGGACGATGATTGCCGTC
CGGGAGAGAGGCCGCCCTGGTTTCCGTCTGATTGTACCTGTCGTCGATAACGTGAGCTGGCGGTTTACTGATGTT
GCGGCGGATGAGCACGAGGAGAAGCCTATTGTGGCGTTTGATCTCGAGGTCTTGGCGGCTGATGTTAAGAAAAGA
TTTGGAAAGGGAGCGGCCCAGTGGGTGAGGAAGGCGGTCGCTGTGACGAGCTGGTATGTTGACGAGAACATGGAG
AGGTGGCGATACGGCGGCAAGAGGCCGAGAAAGGGATCCATGGTGACGACCGAGGATTCCAAGGCGAAACAGAAG
ACGATCAACTCCAAGGGATCCAAGCAGGTCAAAAGGCCAAGGAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail