Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00014
Gene name
Locationscaffold_01:43933..46756
Strand-
Gene length (bp)2823
Transcript length (bp)2823
Coding sequence length (bp)2823
Protein length (aa) 941

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00884 Sulfatase Sulfatase 2.4E-17 453 769

GO

GO Term Description Terminal node
GO:0008484 sulfuric ester hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 36 55 19
2 65 87 22
3 103 125 22
4 145 167 22
5 253 275 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00014
MAVVSSTSPARLFFRFLGHRLLLLFSTLTRFADRRFALALAASGLVSSKLVHVYAHADALPLRALLLWGPSLFGQ
DTVLLLVLRLLLDNGLLPAPVRASASAVAVSVCVLVAAMASIIVSFFAVAGLELHWRNVGAAFDLSALRMLLTGL
LSMGLVMAALLLLAGILQTPCFLVTGMALDLLQWLLNALLPASIRSWVSCSGSGSGSGSEYRHLTSRRDSECDYE
DEDDEKYTDTDAASSLDLRSEPASSRRLLVIVYILVGFSLLAQTVTYIFRPSDASLIFVSWTLPLLPLVELTLSS
SVLTRMRGGGGFQGLDEDVTALSSPPPPFSWLPVDGKKLAGFEDWYIPDRTHYDATRDPIRVTNLHQAPLPEIRT
ALGRLRIRHVVLLELETIRKDVFPLKKDGLIWRKLANGTDSGKLSAEAVQLLSTLTPTANFVTGEYDDGFKHQGR
PKRGGLNFVNAHTSSTYTLKSLTATLCGLTPLLTDFNQEYRNHVYQPCLPHVFEALNRLDGVEKKGGEQMRAAGS
VDEGYEEDWDDEEEGEEEGEREEQQQQQQPADNSSFTSFPWRPTFMQSTTSTFDKQTPLMKAFGFRPDSIIDKEY
LRSNRAKFGPSKVMDNNYFSMPEVTLEEYVRDAFSSARRNKERVFLSHLTSTTHHDWKLPANETYVPLTDDSELS
PLSHFVNCVGYGDRWVRRVLDIIREEGAEDETLVILQGDHGLSNAEIGSVSSYGTGHVGNFHVPLVLSHPHLPPI
DISDAVSSIQVLPTILDLLAESNSLSPSQTTAARDLAANYEGQSLIRPQLDGPSDTGLGAWQFSLVNPGGTMIAV
RERGRPGFRLIVPVVDNVSWRFTDVAADEHEEKPIVAFDLEVLAADVKKRFGKGAAQWVRKAVAVTSWYVDENME
RWRYGGKRPRKGSMVTTEDSKAKQKTINSKGSKQVKRPRR*
Coding >Ophcf2|00014
ATGGCCGTCGTATCCTCCACTTCACCAGCCCGACTCTTTTTCCGCTTTCTGGGTCATCGACTGCTGCTCCTCTTT
AGCACCCTGACGCGCTTCGCAGACCGACGCTTCGCCCTGGCCTTGGCCGCCTCCGGTCTCGTCTCCTCCAAGCTG
GTTCACGTTTACGCCCACGCGGATGCCCTACCGCTGCGGGCGCTGCTGCTCTGGGGCCCCTCCCTGTTCGGGCAG
GATACCGTTCTGCTGCTGGTGCTGAGGCTGTTGCTGGACAATGGTCTTCTCCCGGCTCCGGTCCGGGCTTCGGCG
TCGGCCGTGGCCGTGTCCGTGTGCGTCCTTGTCGCCGCAATGGCCTCCATAATCGTCTCCTTCTTCGCTGTTGCC
GGGCTGGAACTTCACTGGAGGAACGTCGGGGCCGCGTTCGATCTTTCGGCGCTGAGGATGCTGTTGACGGGTCTG
TTGTCCATGGGGCTGGTCATGGCTGCGTTACTGCTGTTGGCTGGTATTCTGCAAACGCCGTGCTTCTTGGTGACG
GGCATGGCGCTGGATCTGCTGCAGTGGCTCCTCAACGCGCTGCTGCCGGCTTCGATCCGGAGTTGGGTTTCCTGC
TCCGGCTCCGGCTCCGGCTCCGGCTCCGAGTACCGGCATCTCACGTCTAGGCGGGACAGCGAATGCGACTACGAA
GACGAAGACGATGAAAAGTACACCGACACCGACGCCGCCTCCTCTCTCGATCTCCGGTCCGAGCCGGCAAGTTCT
CGCCGTTTGCTGGTGATCGTCTATATCCTCGTCGGCTTCTCGCTGCTGGCCCAGACCGTCACATACATCTTCCGT
CCGTCCGACGCCTCGCTCATCTTCGTCTCCTGGACGCTGCCGCTTCTTCCGCTGGTTGAGCTGACGCTCTCGTCA
TCCGTTCTGACCCGCATGCGAGGAGGCGGTGGCTTTCAGGGCCTCGACGAGGACGTCACGGCTCTCTCGAGCCCA
CCACCACCGTTTTCTTGGCTGCCGGTTGACGGGAAGAAGCTCGCCGGCTTCGAGGATTGGTATATTCCGGATCGG
ACGCACTACGACGCGACGCGGGATCCCATCAGGGTGACCAACCTTCATCAGGCTCCGTTGCCGGAAATTCGAACG
GCGCTGGGTCGGCTGCGGATCCGGCACGTTGTTCTCCTTGAACTGGAGACGATTCGAAAGGACGTGTTCCCCCTG
AAGAAGGATGGTCTCATCTGGCGGAAGCTCGCCAACGGGACGGACTCGGGAAAGCTATCGGCTGAGGCGGTACAG
CTGCTTTCGACGCTGACGCCGACGGCCAATTTCGTGACGGGAGAATACGACGATGGCTTCAAGCATCAGGGTCGA
CCCAAGAGGGGCGGACTCAACTTTGTCAATGCGCATACCAGCAGTACTTATACGCTCAAGAGTCTGACGGCGACC
CTGTGCGGACTGACGCCGCTGTTGACGGATTTTAACCAGGAGTACCGGAATCATGTATACCAGCCGTGTTTGCCG
CATGTGTTTGAGGCTTTAAACCGGTTGGATGGCGTTGAGAAGAAGGGAGGGGAGCAGATGAGAGCCGCCGGGTCT
GTTGATGAAGGGTATGAAGAGGATTGGGATGATGAAGAAGAGGGAGAGGAAGAAGGAGAAAGAGAAGAGCAACAA
CAACAACAACAACCCGCAGACAACAGCTCATTCACTTCCTTCCCCTGGCGCCCAACCTTTATGCAGTCAACAACC
TCAACCTTCGACAAACAAACGCCCCTAATGAAAGCCTTTGGCTTCCGACCAGACTCCATCATTGACAAGGAGTAT
CTCCGCAGCAACCGTGCCAAATTCGGCCCCAGCAAAGTGATGGATAACAACTACTTCAGCATGCCCGAGGTAACG
CTGGAAGAGTACGTCCGCGATGCCTTTTCTTCGGCACGCCGTAATAAGGAGCGCGTCTTCTTGTCTCATCTTACC
AGCACGACGCACCATGATTGGAAGCTGCCTGCCAATGAGACGTATGTGCCGTTGACGGATGACTCGGAGCTGAGC
CCTCTTTCTCATTTTGTTAACTGCGTTGGCTACGGAGATCGGTGGGTTCGGCGTGTTCTTGACATCATCCGTGAG
GAGGGTGCCGAGGACGAGACCCTCGTTATACTTCAGGGAGATCACGGGCTATCCAACGCTGAGATTGGAAGCGTC
TCCTCGTACGGAACCGGTCACGTCGGCAACTTCCACGTCCCCCTCGTCCTCTCACATCCTCACCTCCCACCCATC
GACATCTCCGACGCCGTCTCCTCCATCCAAGTACTCCCCACGATTCTCGACCTCCTCGCCGAAAGCAACTCACTC
TCCCCCTCCCAGACGACTGCAGCCCGCGACCTGGCCGCCAACTACGAAGGCCAATCTTTAATCCGCCCGCAGCTC
GACGGGCCGAGCGACACTGGTTTGGGGGCCTGGCAGTTCAGCCTCGTCAATCCGGGTGGGACGATGATTGCCGTC
CGGGAGAGAGGCCGCCCTGGTTTCCGTCTGATTGTACCTGTCGTCGATAACGTGAGCTGGCGGTTTACTGATGTT
GCGGCGGATGAGCACGAGGAGAAGCCTATTGTGGCGTTTGATCTCGAGGTCTTGGCGGCTGATGTTAAGAAAAGA
TTTGGAAAGGGAGCGGCCCAGTGGGTGAGGAAGGCGGTCGCTGTGACGAGCTGGTATGTTGACGAGAACATGGAG
AGGTGGCGATACGGCGGCAAGAGGCCGAGAAAGGGATCCATGGTGACGACCGAGGATTCCAAGGCGAAACAGAAG
ACGATCAACTCCAAGGGATCCAAGCAGGTCAAAAGGCCAAGGAGGTAA
Transcript >Ophcf2|00014
ATGGCCGTCGTATCCTCCACTTCACCAGCCCGACTCTTTTTCCGCTTTCTGGGTCATCGACTGCTGCTCCTCTTT
AGCACCCTGACGCGCTTCGCAGACCGACGCTTCGCCCTGGCCTTGGCCGCCTCCGGTCTCGTCTCCTCCAAGCTG
GTTCACGTTTACGCCCACGCGGATGCCCTACCGCTGCGGGCGCTGCTGCTCTGGGGCCCCTCCCTGTTCGGGCAG
GATACCGTTCTGCTGCTGGTGCTGAGGCTGTTGCTGGACAATGGTCTTCTCCCGGCTCCGGTCCGGGCTTCGGCG
TCGGCCGTGGCCGTGTCCGTGTGCGTCCTTGTCGCCGCAATGGCCTCCATAATCGTCTCCTTCTTCGCTGTTGCC
GGGCTGGAACTTCACTGGAGGAACGTCGGGGCCGCGTTCGATCTTTCGGCGCTGAGGATGCTGTTGACGGGTCTG
TTGTCCATGGGGCTGGTCATGGCTGCGTTACTGCTGTTGGCTGGTATTCTGCAAACGCCGTGCTTCTTGGTGACG
GGCATGGCGCTGGATCTGCTGCAGTGGCTCCTCAACGCGCTGCTGCCGGCTTCGATCCGGAGTTGGGTTTCCTGC
TCCGGCTCCGGCTCCGGCTCCGGCTCCGAGTACCGGCATCTCACGTCTAGGCGGGACAGCGAATGCGACTACGAA
GACGAAGACGATGAAAAGTACACCGACACCGACGCCGCCTCCTCTCTCGATCTCCGGTCCGAGCCGGCAAGTTCT
CGCCGTTTGCTGGTGATCGTCTATATCCTCGTCGGCTTCTCGCTGCTGGCCCAGACCGTCACATACATCTTCCGT
CCGTCCGACGCCTCGCTCATCTTCGTCTCCTGGACGCTGCCGCTTCTTCCGCTGGTTGAGCTGACGCTCTCGTCA
TCCGTTCTGACCCGCATGCGAGGAGGCGGTGGCTTTCAGGGCCTCGACGAGGACGTCACGGCTCTCTCGAGCCCA
CCACCACCGTTTTCTTGGCTGCCGGTTGACGGGAAGAAGCTCGCCGGCTTCGAGGATTGGTATATTCCGGATCGG
ACGCACTACGACGCGACGCGGGATCCCATCAGGGTGACCAACCTTCATCAGGCTCCGTTGCCGGAAATTCGAACG
GCGCTGGGTCGGCTGCGGATCCGGCACGTTGTTCTCCTTGAACTGGAGACGATTCGAAAGGACGTGTTCCCCCTG
AAGAAGGATGGTCTCATCTGGCGGAAGCTCGCCAACGGGACGGACTCGGGAAAGCTATCGGCTGAGGCGGTACAG
CTGCTTTCGACGCTGACGCCGACGGCCAATTTCGTGACGGGAGAATACGACGATGGCTTCAAGCATCAGGGTCGA
CCCAAGAGGGGCGGACTCAACTTTGTCAATGCGCATACCAGCAGTACTTATACGCTCAAGAGTCTGACGGCGACC
CTGTGCGGACTGACGCCGCTGTTGACGGATTTTAACCAGGAGTACCGGAATCATGTATACCAGCCGTGTTTGCCG
CATGTGTTTGAGGCTTTAAACCGGTTGGATGGCGTTGAGAAGAAGGGAGGGGAGCAGATGAGAGCCGCCGGGTCT
GTTGATGAAGGGTATGAAGAGGATTGGGATGATGAAGAAGAGGGAGAGGAAGAAGGAGAAAGAGAAGAGCAACAA
CAACAACAACAACCCGCAGACAACAGCTCATTCACTTCCTTCCCCTGGCGCCCAACCTTTATGCAGTCAACAACC
TCAACCTTCGACAAACAAACGCCCCTAATGAAAGCCTTTGGCTTCCGACCAGACTCCATCATTGACAAGGAGTAT
CTCCGCAGCAACCGTGCCAAATTCGGCCCCAGCAAAGTGATGGATAACAACTACTTCAGCATGCCCGAGGTAACG
CTGGAAGAGTACGTCCGCGATGCCTTTTCTTCGGCACGCCGTAATAAGGAGCGCGTCTTCTTGTCTCATCTTACC
AGCACGACGCACCATGATTGGAAGCTGCCTGCCAATGAGACGTATGTGCCGTTGACGGATGACTCGGAGCTGAGC
CCTCTTTCTCATTTTGTTAACTGCGTTGGCTACGGAGATCGGTGGGTTCGGCGTGTTCTTGACATCATCCGTGAG
GAGGGTGCCGAGGACGAGACCCTCGTTATACTTCAGGGAGATCACGGGCTATCCAACGCTGAGATTGGAAGCGTC
TCCTCGTACGGAACCGGTCACGTCGGCAACTTCCACGTCCCCCTCGTCCTCTCACATCCTCACCTCCCACCCATC
GACATCTCCGACGCCGTCTCCTCCATCCAAGTACTCCCCACGATTCTCGACCTCCTCGCCGAAAGCAACTCACTC
TCCCCCTCCCAGACGACTGCAGCCCGCGACCTGGCCGCCAACTACGAAGGCCAATCTTTAATCCGCCCGCAGCTC
GACGGGCCGAGCGACACTGGTTTGGGGGCCTGGCAGTTCAGCCTCGTCAATCCGGGTGGGACGATGATTGCCGTC
CGGGAGAGAGGCCGCCCTGGTTTCCGTCTGATTGTACCTGTCGTCGATAACGTGAGCTGGCGGTTTACTGATGTT
GCGGCGGATGAGCACGAGGAGAAGCCTATTGTGGCGTTTGATCTCGAGGTCTTGGCGGCTGATGTTAAGAAAAGA
TTTGGAAAGGGAGCGGCCCAGTGGGTGAGGAAGGCGGTCGCTGTGACGAGCTGGTATGTTGACGAGAACATGGAG
AGGTGGCGATACGGCGGCAAGAGGCCGAGAAAGGGATCCATGGTGACGACCGAGGATTCCAAGGCGAAACAGAAG
ACGATCAACTCCAAGGGATCCAAGCAGGTCAAAAGGCCAAGGAGGTAA
Gene >Ophcf2|00014
ATGGCCGTCGTATCCTCCACTTCACCAGCCCGACTCTTTTTCCGCTTTCTGGGTCATCGACTGCTGCTCCTCTTT
AGCACCCTGACGCGCTTCGCAGACCGACGCTTCGCCCTGGCCTTGGCCGCCTCCGGTCTCGTCTCCTCCAAGCTG
GTTCACGTTTACGCCCACGCGGATGCCCTACCGCTGCGGGCGCTGCTGCTCTGGGGCCCCTCCCTGTTCGGGCAG
GATACCGTTCTGCTGCTGGTGCTGAGGCTGTTGCTGGACAATGGTCTTCTCCCGGCTCCGGTCCGGGCTTCGGCG
TCGGCCGTGGCCGTGTCCGTGTGCGTCCTTGTCGCCGCAATGGCCTCCATAATCGTCTCCTTCTTCGCTGTTGCC
GGGCTGGAACTTCACTGGAGGAACGTCGGGGCCGCGTTCGATCTTTCGGCGCTGAGGATGCTGTTGACGGGTCTG
TTGTCCATGGGGCTGGTCATGGCTGCGTTACTGCTGTTGGCTGGTATTCTGCAAACGCCGTGCTTCTTGGTGACG
GGCATGGCGCTGGATCTGCTGCAGTGGCTCCTCAACGCGCTGCTGCCGGCTTCGATCCGGAGTTGGGTTTCCTGC
TCCGGCTCCGGCTCCGGCTCCGGCTCCGAGTACCGGCATCTCACGTCTAGGCGGGACAGCGAATGCGACTACGAA
GACGAAGACGATGAAAAGTACACCGACACCGACGCCGCCTCCTCTCTCGATCTCCGGTCCGAGCCGGCAAGTTCT
CGCCGTTTGCTGGTGATCGTCTATATCCTCGTCGGCTTCTCGCTGCTGGCCCAGACCGTCACATACATCTTCCGT
CCGTCCGACGCCTCGCTCATCTTCGTCTCCTGGACGCTGCCGCTTCTTCCGCTGGTTGAGCTGACGCTCTCGTCA
TCCGTTCTGACCCGCATGCGAGGAGGCGGTGGCTTTCAGGGCCTCGACGAGGACGTCACGGCTCTCTCGAGCCCA
CCACCACCGTTTTCTTGGCTGCCGGTTGACGGGAAGAAGCTCGCCGGCTTCGAGGATTGGTATATTCCGGATCGG
ACGCACTACGACGCGACGCGGGATCCCATCAGGGTGACCAACCTTCATCAGGCTCCGTTGCCGGAAATTCGAACG
GCGCTGGGTCGGCTGCGGATCCGGCACGTTGTTCTCCTTGAACTGGAGACGATTCGAAAGGACGTGTTCCCCCTG
AAGAAGGATGGTCTCATCTGGCGGAAGCTCGCCAACGGGACGGACTCGGGAAAGCTATCGGCTGAGGCGGTACAG
CTGCTTTCGACGCTGACGCCGACGGCCAATTTCGTGACGGGAGAATACGACGATGGCTTCAAGCATCAGGGTCGA
CCCAAGAGGGGCGGACTCAACTTTGTCAATGCGCATACCAGCAGTACTTATACGCTCAAGAGTCTGACGGCGACC
CTGTGCGGACTGACGCCGCTGTTGACGGATTTTAACCAGGAGTACCGGAATCATGTATACCAGCCGTGTTTGCCG
CATGTGTTTGAGGCTTTAAACCGGTTGGATGGCGTTGAGAAGAAGGGAGGGGAGCAGATGAGAGCCGCCGGGTCT
GTTGATGAAGGGTATGAAGAGGATTGGGATGATGAAGAAGAGGGAGAGGAAGAAGGAGAAAGAGAAGAGCAACAA
CAACAACAACAACCCGCAGACAACAGCTCATTCACTTCCTTCCCCTGGCGCCCAACCTTTATGCAGTCAACAACC
TCAACCTTCGACAAACAAACGCCCCTAATGAAAGCCTTTGGCTTCCGACCAGACTCCATCATTGACAAGGAGTAT
CTCCGCAGCAACCGTGCCAAATTCGGCCCCAGCAAAGTGATGGATAACAACTACTTCAGCATGCCCGAGGTAACG
CTGGAAGAGTACGTCCGCGATGCCTTTTCTTCGGCACGCCGTAATAAGGAGCGCGTCTTCTTGTCTCATCTTACC
AGCACGACGCACCATGATTGGAAGCTGCCTGCCAATGAGACGTATGTGCCGTTGACGGATGACTCGGAGCTGAGC
CCTCTTTCTCATTTTGTTAACTGCGTTGGCTACGGAGATCGGTGGGTTCGGCGTGTTCTTGACATCATCCGTGAG
GAGGGTGCCGAGGACGAGACCCTCGTTATACTTCAGGGAGATCACGGGCTATCCAACGCTGAGATTGGAAGCGTC
TCCTCGTACGGAACCGGTCACGTCGGCAACTTCCACGTCCCCCTCGTCCTCTCACATCCTCACCTCCCACCCATC
GACATCTCCGACGCCGTCTCCTCCATCCAAGTACTCCCCACGATTCTCGACCTCCTCGCCGAAAGCAACTCACTC
TCCCCCTCCCAGACGACTGCAGCCCGCGACCTGGCCGCCAACTACGAAGGCCAATCTTTAATCCGCCCGCAGCTC
GACGGGCCGAGCGACACTGGTTTGGGGGCCTGGCAGTTCAGCCTCGTCAATCCGGGTGGGACGATGATTGCCGTC
CGGGAGAGAGGCCGCCCTGGTTTCCGTCTGATTGTACCTGTCGTCGATAACGTGAGCTGGCGGTTTACTGATGTT
GCGGCGGATGAGCACGAGGAGAAGCCTATTGTGGCGTTTGATCTCGAGGTCTTGGCGGCTGATGTTAAGAAAAGA
TTTGGAAAGGGAGCGGCCCAGTGGGTGAGGAAGGCGGTCGCTGTGACGAGCTGGTATGTTGACGAGAACATGGAG
AGGTGGCGATACGGCGGCAAGAGGCCGAGAAAGGGATCCATGGTGACGACCGAGGATTCCAAGGCGAAACAGAAG
ACGATCAACTCCAAGGGATCCAAGCAGGTCAAAAGGCCAAGGAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail