Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00008
Gene name
Locationscaffold_01:26914..28263
Strand+
Gene length (bp)1349
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 1.4E-15 111 238
PF02469 Fasciclin Fasciclin domain 2.3E-26 251 402

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1349 0.0542 0.9022 0.055 0.1333 0.0739 0.5595 0.2063 0.3286 0.0052

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999597

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2136
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1378
Ophiocordyceps australis map64 (Brazil) OphauB2|702
Ophiocordyceps camponoti-floridani Ophcf2|00008 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6473
Ophiocordyceps kimflemingae Ophio5|4444
Ophiocordyceps subramaniannii Hirsu2|2561

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00008
MRSVLASALALALSAATAFGASDRSQVPLSGPTDHDADELSLARGPLVPQVSSLLSHAVDRLAGAVDSAAIDVLQ
GARHPRLSTELADSLASGAGGRDRTLYELIRACEHTSRFADAVDHHPDVVKLLNGSSSRDLTLFVPTNAAFRGLP
DSHKPGREFVERVLKYHVGLGRYPAGRILQTHTLPTALDEELLAGEPQRLRTSIGLGGVEINFYSKVVAINIEAS
NGIIHAVNHILIPPFMVGRILSLFPSQFSTLLLAYEKTDFVDFIHHVSLNGSTVFAPSNNAFGRLGPRANAFLFN
TSKGRRYLRALLKYHISPNATLYTDAFYDATTEDAAGRPSAEGLEREHYDLPTLLGDARIGVDIARLGGFSAVRV
NGFAHISVRDGVAKNGVIQVVDQVLMPPRKGHPAARSRRALTVKELMARLEPYL*
Coding >Ophcf2|00008
ATGAGGTCCGTCCTCGCATCCGCCCTCGCCCTCGCCCTCTCGGCCGCCACCGCCTTCGGAGCCTCCGATCGGTCT
CAGGTCCCGCTCTCCGGCCCGACGGACCACGATGCCGACGAGCTCTCTCTCGCCCGCGGCCCGCTGGTGCCTCAG
GTGTCGTCGCTGCTGAGCCACGCGGTAGACCGGCTGGCGGGCGCCGTCGACAGCGCCGCCATTGACGTCCTGCAG
GGCGCTCGTCACCCGCGGCTGTCGACGGAGCTGGCTGACTCGCTGGCTTCCGGGGCGGGCGGTCGGGATCGGACC
CTGTACGAGCTCATCCGGGCGTGCGAACATACATCGCGCTTCGCCGATGCCGTCGACCATCACCCGGATGTGGTG
AAGCTACTCAACGGCTCGTCCAGCCGCGACCTGACGCTCTTCGTGCCGACCAACGCTGCCTTCCGCGGTCTACCC
GACAGCCATAAGCCTGGTAGGGAGTTTGTCGAGCGCGTGCTCAAATATCACGTCGGCCTCGGGCGTTATCCGGCT
GGACGCATCTTGCAAACGCATACGCTGCCGACGGCGCTGGACGAGGAGCTTCTGGCGGGTGAGCCGCAGCGGTTG
CGGACGAGCATTGGACTGGGGGGCGTTGAAATTAATTTCTACAGCAAGGTCGTGGCCATAAACATCGAAGCCTCC
AATGGCATCATCCACGCCGTCAATCACATCCTCATCCCCCCCTTCATGGTGGGACGCATCCTCTCCCTCTTCCCC
AGCCAATTCTCAACGCTCCTCCTGGCCTACGAAAAGACCGACTTCGTCGACTTCATCCATCACGTCAGCCTCAAC
GGCAGCACCGTCTTCGCTCCGAGCAACAACGCATTCGGCCGTCTCGGTCCCCGCGCAAACGCCTTCCTCTTCAAC
ACGTCAAAGGGCCGACGATACCTTCGCGCCCTGCTCAAGTACCACATCTCGCCCAACGCCACGCTCTACACCGAT
GCCTTTTACGATGCCACCACTGAGGATGCGGCCGGTAGGCCTTCCGCTGAAGGGCTTGAGCGGGAGCATTATGAC
CTGCCGACGTTGTTGGGTGATGCGCGTATTGGGGTTGATATCGCTCGCTTGGGGGGCTTCTCTGCCGTTCGCGTC
AATGGCTTCGCTCACATCTCGGTTCGGGACGGTGTTGCGAAGAACGGCGTCATTCAGGTTGTTGATCAGGTCTTG
ATGCCGCCTCGGAAGGGTCATCCGGCTGCGAGGTCGAGGCGGGCGCTGACGGTCAAGGAGCTGATGGCCAGGCTG
GAGCCGTATTTGTGA
Transcript >Ophcf2|00008
ATGAGGTCCGTCCTCGCATCCGCCCTCGCCCTCGCCCTCTCGGCCGCCACCGCCTTCGGAGCCTCCGATCGGTCT
CAGGTCCCGCTCTCCGGCCCGACGGACCACGATGCCGACGAGCTCTCTCTCGCCCGCGGCCCGCTGGTGCCTCAG
GTGTCGTCGCTGCTGAGCCACGCGGTAGACCGGCTGGCGGGCGCCGTCGACAGCGCCGCCATTGACGTCCTGCAG
GGCGCTCGTCACCCGCGGCTGTCGACGGAGCTGGCTGACTCGCTGGCTTCCGGGGCGGGCGGTCGGGATCGGACC
CTGTACGAGCTCATCCGGGCGTGCGAACATACATCGCGCTTCGCCGATGCCGTCGACCATCACCCGGATGTGGTG
AAGCTACTCAACGGCTCGTCCAGCCGCGACCTGACGCTCTTCGTGCCGACCAACGCTGCCTTCCGCGGTCTACCC
GACAGCCATAAGCCTGGTAGGGAGTTTGTCGAGCGCGTGCTCAAATATCACGTCGGCCTCGGGCGTTATCCGGCT
GGACGCATCTTGCAAACGCATACGCTGCCGACGGCGCTGGACGAGGAGCTTCTGGCGGGTGAGCCGCAGCGGTTG
CGGACGAGCATTGGACTGGGGGGCGTTGAAATTAATTTCTACAGCAAGGTCGTGGCCATAAACATCGAAGCCTCC
AATGGCATCATCCACGCCGTCAATCACATCCTCATCCCCCCCTTCATGGTGGGACGCATCCTCTCCCTCTTCCCC
AGCCAATTCTCAACGCTCCTCCTGGCCTACGAAAAGACCGACTTCGTCGACTTCATCCATCACGTCAGCCTCAAC
GGCAGCACCGTCTTCGCTCCGAGCAACAACGCATTCGGCCGTCTCGGTCCCCGCGCAAACGCCTTCCTCTTCAAC
ACGTCAAAGGGCCGACGATACCTTCGCGCCCTGCTCAAGTACCACATCTCGCCCAACGCCACGCTCTACACCGAT
GCCTTTTACGATGCCACCACTGAGGATGCGGCCGGTAGGCCTTCCGCTGAAGGGCTTGAGCGGGAGCATTATGAC
CTGCCGACGTTGTTGGGTGATGCGCGTATTGGGGTTGATATCGCTCGCTTGGGGGGCTTCTCTGCCGTTCGCGTC
AATGGCTTCGCTCACATCTCGGTTCGGGACGGTGTTGCGAAGAACGGCGTCATTCAGGTTGTTGATCAGGTCTTG
ATGCCGCCTCGGAAGGGTCATCCGGCTGCGAGGTCGAGGCGGGCGCTGACGGTCAAGGAGCTGATGGCCAGGCTG
GAGCCGTATTTGTGA
Gene >Ophcf2|00008
ATGAGGTCCGTCCTCGCATCCGCCCTCGCCCTCGCCCTCTCGGCCGCCACCGCCTTCGGAGCCTCCGATCGGTCT
CAGGTCCCGCTCTCCGGCCCGACGGACCACGATGCCGACGAGCTCTCTCTCGCCCGCGGCCCGCTGGTGCCTCAG
GTGTCGTCGCTGCTGAGCCACGCGGTAGACCGGCTGGCGGGCGCCGTCGACAGCGCCGCCATTGACGTCCTGCAG
GGCGCTCGTCACCCGCGGCTGTCGACGGAGCTGGCTGACTCGCTGGCTTCCGGGGCGGGCGGTCGGGATCGGACC
CTGTACGAGCTCATCCGGGCGTGCGAACATACATCGCGCTTCGCCGATGCCGTCGACCATCACCCGGATGTGGTG
AAGCTACTCAACGGCTCGTCCAGCCGCGACCTGACGCTCTTCGTGCCGACCAACGCTGCCTTCCGCGGTCTACCC
GACAGCCATAAGCCTGGTAGGGAGTTTGTCGAGCGCGTGCTCAAATATCACGTCGGCCTCGGGCGTTATCCGGCT
GGACGCATCTTGCAAACGCATACGCTGCCGACGGCGCTGGACGAGGAGCTTCTGGCGGGTGAGCCGCAGCGGTTG
CGGACGAGCATTGGACTGGGGGGCGTTGAAATTAATTTCTACAGCAAGGTCGTGGCCATAAACATCGTGAGTTCT
CTTCTCGTGTCTTCATACGTGGACGATACTAACGCATGTACGACTTCCAGGAAGCCTCCAATGGCATCATCCACG
CCGTCAATCACATCCTCATCCCCCCCTTCATGGTGGGACGCATCCTCTCCCTCTTCCCCAGCCAATTCTCAACGC
TCCTCCTGGCCTACGAAAAGACCGACTTCGTCGACTTCATCCATCACGTCAGCCTCAACGGCAGCACCGTCTTCG
CTCCGAGCAACAACGCATTCGGCCGTCTCGGTCCCCGCGCAAACGCCTTCCTCTTCAACACGTCAAAGGGCCGAC
GATACCTTCGCGCCCTGCTCAAGTACCACATCTCGCCCAACGCCACGCTCTACACCGATGCCTTTTACGATGCCA
CCACTGAGGATGCGGCCGGTAGGCCTTCCGCTGAAGGGCTTGAGCGGGAGCATTATGACCTGCCGACGTTGTTGG
GTGATGCGCGTATTGGGGTTGATATCGCTCGCTTGGGGGGCTTCTCTGCCGTTCGCGTCAATGGCTTCGCTCACA
TCTCGGTTCGGGACGGTGTTGCGAAGAACGGCGTCATTCAGGTTGTTGATCAGGTCTTGATGCCGCCTCGGAAGG
GTCATCCGGCTGCGAGGTCGAGGCGGGCGCTGACGGTCAAGGAGCTGATGGCCAGGCTGGAGCCGTATTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail