Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|00006
Gene name
Locationscaffold_01:20603..23396
Strand-
Gene length (bp)2793
Transcript length (bp)2646
Coding sequence length (bp)2646
Protein length (aa) 882

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11838 ERAP1_C ERAP1-like C-terminal domain 1.3E-88 540 857
PF01433 Peptidase_M1 Peptidase family M1 domain 9.1E-85 249 466
PF17900 Peptidase_M1_N Peptidase M1 N-terminal domain 6.9E-53 30 214

GO

GO Term Description Terminal node
GO:0008237 metallopeptidase activity Yes
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular 0.5566 0.2389 0.676 0.0868 0.2385 0.0668 0.2176 0.0897 0.1826 0.1239

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup135
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1094
Ophiocordyceps australis 1348a (Ghana) OphauG2|6966
Ophiocordyceps australis map64 (Brazil) OphauB2|2827
Ophiocordyceps australis map64 (Brazil) OphauB2|3653
Ophiocordyceps camponoti-floridani Ophcf2|00006 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03696
Ophiocordyceps camponoti-rufipedis Ophun1|333
Ophiocordyceps camponoti-rufipedis Ophun1|6470
Ophiocordyceps kimflemingae Ophio5|4442
Ophiocordyceps kimflemingae Ophio5|5778
Ophiocordyceps subramaniannii Hirsu2|10785
Ophiocordyceps subramaniannii Hirsu2|9568

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|00006
MCRGPACVDMSGGGASGNSQGRELLPANVVPRHYDVTLEPNFTKFTFEGTVIIDLDVAQDSSSISLNTLEIDIHS
AKVSSDGKVVSSNPRVSHDEAKQVTKFDFDGSLPKGCRAQLEIKFTGQLNDKMAGFYRSTYKRADGSQGILATTQ
MEPTDARRAFPCFDEPALKARFTVTLVAEKRLTCLSNMDVASESDMGAKRAVRFNTSPPMSTYLVAFIVGELNYV
ESRDFRVPVRVYAPPGQDIENGRFSLDLAVKTLKFYERVFGIDFPLPKMDQVAIPDFAQGAMENWGLITYRVVDL
LLDQNASGAATKERVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATWASWYSCNVFYPEWHVWQTYVTDNLQS
ALGLDSLRSSHPIEVPVKRADEINQIFDAISYSKGSCVLRMISIYLGEETFLEGVRRYLKKHAYGNTQTGDLWAA
LSDASGKPVQDIMTAWTKKVGFPVVTVTEDDKARTFKVKQNRFLRTGDVKPEEDQVLYPIFLGLRSEGGVDTELA
LTERERELKMPAGDLLKLNANHSGIYRTSYTPERLEKLGRAARDGRLTVEDRAGLLADAGALATSGYQKTSGLLS
LLQGFGSESEFVVWSEIVGRLAAIQSTWMFEDAAVRNGLEALMRDLISPKAHEMGWAFSDDDGHVEQQFKALTFE
AAGLSGDKAIVNACKEMLKSFAGGDKKAIHPNIRKSVFNVSLKYGGKEEYDEILGLYRSSTNSDERNTCLRSLGR
AKDPELIKRTLGLVFSDEVKDQDSYLPISGLRSHPEGIEAMFKWMKENWETMYKRLPPGLSMLGTMVSLMTSGFS
TQKQLDEVDRFFGDKNNNGYDQALAQTKDAIRSKISWLGRDSQDVAAWLKAKGYAG*
Coding >Ophcf2|00006
ATGTGCAGGGGCCCGGCTTGCGTCGATATGTCGGGCGGAGGAGCCTCTGGCAATTCCCAGGGCCGCGAGTTGCTG
CCCGCCAACGTAGTGCCTCGCCACTACGATGTGACGCTTGAGCCCAACTTTACCAAGTTTACCTTTGAGGGAACC
GTCATCATCGACCTCGACGTCGCCCAGGACTCGTCTTCCATCTCTCTCAACACGCTCGAGATTGACATTCACTCG
GCCAAGGTCTCGTCCGATGGCAAGGTCGTCAGCTCCAACCCTCGCGTCTCGCACGACGAGGCCAAGCAGGTCACA
AAGTTCGACTTCGATGGTTCGCTCCCCAAGGGCTGCCGTGCCCAGCTCGAGATCAAGTTCACCGGCCAGCTCAAT
GACAAGATGGCCGGCTTCTACCGCTCCACCTACAAGCGCGCCGACGGCAGCCAGGGCATCCTCGCCACCACTCAG
ATGGAGCCCACCGACGCCCGCCGAGCTTTTCCTTGCTTCGACGAGCCCGCACTCAAGGCCAGATTTACCGTGACG
CTCGTGGCCGAAAAGCGCCTGACGTGCCTCAGCAATATGGACGTGGCCTCCGAGTCTGACATGGGTGCCAAAAGG
GCTGTTCGCTTCAATACGTCGCCTCCAATGTCCACCTATCTCGTCGCCTTCATCGTCGGCGAGCTGAACTACGTC
GAGTCGCGCGACTTCCGTGTCCCGGTCCGCGTCTACGCTCCTCCCGGTCAGGACATTGAAAACGGCCGCTTCTCG
CTCGACTTGGCCGTCAAGACGCTCAAGTTCTACGAGCGTGTCTTCGGCATCGACTTTCCCCTGCCCAAGATGGAC
CAGGTAGCCATCCCCGACTTCGCTCAGGGCGCCATGGAGAACTGGGGCCTCATCACCTACCGTGTCGTCGACCTC
CTGCTCGACCAAAACGCCAGCGGTGCCGCCACCAAGGAGCGCGTCGCCGAGGTGGTGCAGCACGAGCTGGCCCAT
CAGTGGTTCGGCAACCTCGTCACCATGGACTGGTGGGAGGGCCTCTGGCTCAACGAGGGCTTCGCCACCTGGGCC
TCGTGGTACTCGTGCAACGTCTTCTACCCCGAGTGGCACGTCTGGCAGACGTACGTGACGGACAACCTGCAGTCG
GCCCTCGGACTCGATTCGCTCCGGAGCAGCCACCCGATCGAGGTGCCCGTCAAGCGCGCCGACGAGATCAACCAG
ATCTTCGACGCCATCTCGTACTCCAAGGGCTCGTGCGTCCTGCGCATGATCTCCATCTATCTCGGCGAGGAGACC
TTCCTCGAGGGCGTCCGCCGCTACCTCAAGAAGCACGCCTATGGCAACACTCAGACGGGTGACCTGTGGGCTGCC
CTCAGCGACGCCAGCGGCAAGCCTGTTCAGGACATCATGACGGCCTGGACCAAAAAGGTCGGCTTCCCGGTCGTG
ACGGTGACGGAGGACGACAAGGCTCGTACCTTCAAGGTCAAGCAGAACCGCTTCCTCAGGACGGGCGACGTCAAG
CCCGAGGAGGACCAGGTCCTTTACCCCATCTTCCTCGGTCTGCGCTCCGAGGGAGGCGTCGACACTGAGCTGGCT
TTAACGGAGCGCGAGAGGGAGCTCAAGATGCCGGCCGGCGACCTCTTGAAGCTCAACGCCAACCATTCGGGCATC
TACCGCACCTCGTACACGCCGGAGCGGCTCGAGAAGCTGGGTCGCGCCGCCCGCGACGGCCGCCTGACGGTCGAG
GACAGGGCCGGCTTGCTGGCCGACGCCGGCGCGCTCGCCACGTCGGGCTACCAGAAGACGTCGGGCCTGCTGAGC
CTGCTGCAGGGCTTCGGCTCCGAGTCCGAGTTTGTCGTCTGGAGCGAGATCGTTGGCCGACTAGCGGCCATCCAG
AGCACCTGGATGTTCGAGGACGCAGCCGTGCGCAACGGGCTCGAGGCTCTGATGCGCGACCTGATCAGCCCCAAG
GCGCACGAGATGGGCTGGGCTTTTTCCGACGACGACGGCCACGTCGAGCAGCAGTTTAAGGCCTTGACGTTTGAG
GCGGCGGGCCTCAGCGGCGACAAGGCCATCGTGAACGCCTGCAAGGAGATGCTGAAGAGTTTTGCAGGTGGCGAC
AAGAAGGCCATCCACCCCAACATTCGCAAGAGCGTCTTTAACGTGTCGCTCAAGTACGGCGGCAAGGAAGAGTAC
GACGAGATCCTCGGACTCTATCGGTCCTCGACCAACAGCGACGAGCGCAACACGTGCCTCCGCAGCCTGGGGCGG
GCCAAGGACCCGGAGCTCATCAAGCGGACGCTGGGCCTGGTCTTTAGCGACGAGGTCAAGGACCAGGACAGCTAT
CTGCCCATCAGCGGACTGCGGTCGCACCCAGAGGGCATCGAGGCCATGTTTAAGTGGATGAAGGAGAACTGGGAG
ACCATGTACAAGCGGCTGCCGCCGGGGCTGTCGATGCTGGGCACCATGGTGTCGCTCATGACGTCGGGCTTCTCA
ACGCAGAAGCAGCTAGACGAGGTGGACCGCTTCTTCGGCGACAAGAACAACAACGGCTACGACCAGGCGCTGGCG
CAGACCAAGGACGCGATCCGGTCCAAGATATCGTGGCTCGGTCGCGACTCGCAGGACGTGGCGGCCTGGCTCAAG
GCCAAGGGCTACGCCGGATGA
Transcript >Ophcf2|00006
ATGTGCAGGGGCCCGGCTTGCGTCGATATGTCGGGCGGAGGAGCCTCTGGCAATTCCCAGGGCCGCGAGTTGCTG
CCCGCCAACGTAGTGCCTCGCCACTACGATGTGACGCTTGAGCCCAACTTTACCAAGTTTACCTTTGAGGGAACC
GTCATCATCGACCTCGACGTCGCCCAGGACTCGTCTTCCATCTCTCTCAACACGCTCGAGATTGACATTCACTCG
GCCAAGGTCTCGTCCGATGGCAAGGTCGTCAGCTCCAACCCTCGCGTCTCGCACGACGAGGCCAAGCAGGTCACA
AAGTTCGACTTCGATGGTTCGCTCCCCAAGGGCTGCCGTGCCCAGCTCGAGATCAAGTTCACCGGCCAGCTCAAT
GACAAGATGGCCGGCTTCTACCGCTCCACCTACAAGCGCGCCGACGGCAGCCAGGGCATCCTCGCCACCACTCAG
ATGGAGCCCACCGACGCCCGCCGAGCTTTTCCTTGCTTCGACGAGCCCGCACTCAAGGCCAGATTTACCGTGACG
CTCGTGGCCGAAAAGCGCCTGACGTGCCTCAGCAATATGGACGTGGCCTCCGAGTCTGACATGGGTGCCAAAAGG
GCTGTTCGCTTCAATACGTCGCCTCCAATGTCCACCTATCTCGTCGCCTTCATCGTCGGCGAGCTGAACTACGTC
GAGTCGCGCGACTTCCGTGTCCCGGTCCGCGTCTACGCTCCTCCCGGTCAGGACATTGAAAACGGCCGCTTCTCG
CTCGACTTGGCCGTCAAGACGCTCAAGTTCTACGAGCGTGTCTTCGGCATCGACTTTCCCCTGCCCAAGATGGAC
CAGGTAGCCATCCCCGACTTCGCTCAGGGCGCCATGGAGAACTGGGGCCTCATCACCTACCGTGTCGTCGACCTC
CTGCTCGACCAAAACGCCAGCGGTGCCGCCACCAAGGAGCGCGTCGCCGAGGTGGTGCAGCACGAGCTGGCCCAT
CAGTGGTTCGGCAACCTCGTCACCATGGACTGGTGGGAGGGCCTCTGGCTCAACGAGGGCTTCGCCACCTGGGCC
TCGTGGTACTCGTGCAACGTCTTCTACCCCGAGTGGCACGTCTGGCAGACGTACGTGACGGACAACCTGCAGTCG
GCCCTCGGACTCGATTCGCTCCGGAGCAGCCACCCGATCGAGGTGCCCGTCAAGCGCGCCGACGAGATCAACCAG
ATCTTCGACGCCATCTCGTACTCCAAGGGCTCGTGCGTCCTGCGCATGATCTCCATCTATCTCGGCGAGGAGACC
TTCCTCGAGGGCGTCCGCCGCTACCTCAAGAAGCACGCCTATGGCAACACTCAGACGGGTGACCTGTGGGCTGCC
CTCAGCGACGCCAGCGGCAAGCCTGTTCAGGACATCATGACGGCCTGGACCAAAAAGGTCGGCTTCCCGGTCGTG
ACGGTGACGGAGGACGACAAGGCTCGTACCTTCAAGGTCAAGCAGAACCGCTTCCTCAGGACGGGCGACGTCAAG
CCCGAGGAGGACCAGGTCCTTTACCCCATCTTCCTCGGTCTGCGCTCCGAGGGAGGCGTCGACACTGAGCTGGCT
TTAACGGAGCGCGAGAGGGAGCTCAAGATGCCGGCCGGCGACCTCTTGAAGCTCAACGCCAACCATTCGGGCATC
TACCGCACCTCGTACACGCCGGAGCGGCTCGAGAAGCTGGGTCGCGCCGCCCGCGACGGCCGCCTGACGGTCGAG
GACAGGGCCGGCTTGCTGGCCGACGCCGGCGCGCTCGCCACGTCGGGCTACCAGAAGACGTCGGGCCTGCTGAGC
CTGCTGCAGGGCTTCGGCTCCGAGTCCGAGTTTGTCGTCTGGAGCGAGATCGTTGGCCGACTAGCGGCCATCCAG
AGCACCTGGATGTTCGAGGACGCAGCCGTGCGCAACGGGCTCGAGGCTCTGATGCGCGACCTGATCAGCCCCAAG
GCGCACGAGATGGGCTGGGCTTTTTCCGACGACGACGGCCACGTCGAGCAGCAGTTTAAGGCCTTGACGTTTGAG
GCGGCGGGCCTCAGCGGCGACAAGGCCATCGTGAACGCCTGCAAGGAGATGCTGAAGAGTTTTGCAGGTGGCGAC
AAGAAGGCCATCCACCCCAACATTCGCAAGAGCGTCTTTAACGTGTCGCTCAAGTACGGCGGCAAGGAAGAGTAC
GACGAGATCCTCGGACTCTATCGGTCCTCGACCAACAGCGACGAGCGCAACACGTGCCTCCGCAGCCTGGGGCGG
GCCAAGGACCCGGAGCTCATCAAGCGGACGCTGGGCCTGGTCTTTAGCGACGAGGTCAAGGACCAGGACAGCTAT
CTGCCCATCAGCGGACTGCGGTCGCACCCAGAGGGCATCGAGGCCATGTTTAAGTGGATGAAGGAGAACTGGGAG
ACCATGTACAAGCGGCTGCCGCCGGGGCTGTCGATGCTGGGCACCATGGTGTCGCTCATGACGTCGGGCTTCTCA
ACGCAGAAGCAGCTAGACGAGGTGGACCGCTTCTTCGGCGACAAGAACAACAACGGCTACGACCAGGCGCTGGCG
CAGACCAAGGACGCGATCCGGTCCAAGATATCGTGGCTCGGTCGCGACTCGCAGGACGTGGCGGCCTGGCTCAAG
GCCAAGGGCTACGCCGGATGA
Gene >Ophcf2|00006
ATGTGCAGGGGCCCGGCTTGCGTCGATATGTCGGGCGGAGGAGCCTCTGGCAATTCCCAGGGCCGCGAGTTGCTG
CCCGCCAACGTAGTGCCTCGCCACTACGATGTGACGCTTGAGCCCAACTTTACCAAGTTTACCTTTGAGGGAACC
GTCATCATCGACCTCGACGTCGCCCAGGACTCGTCTTCCATCTCTCTCAACACGCTCGAGATTGACATTCACTCG
GCCAAGGTCTCGTCCGATGGCAAGGTCGTCAGGTCGGTTTTTCTTTCTTCCCTTGCCACCAGGCACAGCTGACGC
AAGGACCCCAGCTCCAACCCTCGCGTCTCGCACGACGAGGCCAAGCAGGTCACAAAGTTCGACTTCGATGGTTCG
CTCCCCAAGGGCTGCCGTGCCCAGCTCGAGATCAAGTTCACCGGCCAGCTCAATGACAAGATGGCCGGCTTCTAC
CGCTCCACCTACAAGCGCGCCGACGGCAGCCAGGGCATCCTCGCCACCACTCAGATGGAGCCCACCGACGCCCGC
CGAGCTTTTCCTTGCTTCGACGAGCCCGCACTCAAGGCCAGATTTACCGTGACGCTCGTGGCCGAAAAGCGCCTG
ACGTGCCTCAGCAATATGGACGTGGCCTCCGAGTCTGACATGGGTGCCAAAAGGGCTGTTCGCTTCAATACGTCG
CCTCCAATGTCCACCTATCTCGTCGCCTTCATCGTCGGCGAGCTGAACTACGTCGAGTCGCGCGACTTCCGTGTC
CCGGTCCGCGTCTACGCTCCTCCCGGTCAGGACATTGAAAACGGCCGCTTCTCGCTCGACTTGGCCGTCAAGACG
CTCAAGTTCTACGAGCGTGTCTTCGGCATCGACTTTCCCCTGCCCAAGATGGACCAGGTAGCCATCCCCGACTTC
GCTCAGGGCGCCATGGAGAACTGGGGCCTCATCACCTACCGTGTCGTCGACCTCCTGCTCGACCAAAACGCCAGC
GGTGCCGCCACCAAGGAGCGCGTCGCCGAGGTGGTGCAGCACGAGCTGGCCCATCAGTGGTTCGGCAACCTCGTC
ACCATGGACTGGTGGGAGGGCCTCTGGCTCAACGAGGGCTTCGCCACCTGGGCCTCGTGGTACTCGTGCAACGTC
TTCTACCCCGAGTGGCACGTCTGGCAGACGTACGTGACGGACAACCTGCAGTCGGCCCTCGGACTCGATTCGCTC
CGGAGCAGCCACCCGATCGAGGTGCCCGTCAAGCGCGCCGACGAGATCAACCAGATCTTCGACGCCATCTCGTAC
TCCAAGGGCTCGTGCGTCCTGCGCATGATCTCCATCTATCTCGGCGAGGAGACCTTCCTCGAGGGCGTCCGCCGC
TACCTCAAGAAGCACGCCTATGGCAACACTCAGACGGGTGACCTGTGGGCTGCCCTCAGCGACGCCAGCGGCAAG
CCTGTTCAGGACATCATGACGGCCTGGACCAAAAAGGTCGGCTTCCCGGTCGTGACGGTGACGGAGGACGACAAG
GCTCGTACCTTCAAGGTCAAGCAGAACCGCTTCCTCAGGACGGGCGACGTCAAGCCCGAGGAGGACCAGGTCCTT
TACCCCATCTTCCTCGGTCTGCGCTCCGAGGGAGGCGTCGACACTGAGCTGGCTTTAACGGAGCGCGAGAGGGAG
CTCAAGATGCCGGCCGGCGACCTCTTGAAGCTCAACGCCAACCATTCGGGCATCTACCGCACCTCGTACACGCCG
GAGCGGCTCGAGAAGCTGGGTCGCGCCGCCCGCGACGGCCGCCTGACGGTCGAGGACAGGGCCGGCTTGCTGGCC
GACGCCGGCGCGCTCGCCACGTCGGGCTACCAGAAGACGTCGGGCCTGCTGAGCCTGCTGCAGGGCTTCGGCTCC
GAGTCCGAGTTTGTCGTCTGGAGCGAGATCGTTGGCCGACTAGCGGCCATCCAGAGCACCTGGATGTTCGAGGAC
GCAGCCGTGCGCAACGGGCTCGAGGCTCTGATGCGCGACCTGATCAGCCCCAAGGCGCACGAGATGGGCTGGGCT
TTTTCCGACGACGACGGCCACGTCGAGCAGCAGTTTAAGGCCTTGACGTTTGAGGCGGCGGGCCTCAGCGGCGAC
AAGGCCATCGTGAACGCCTGCAAGGAGATGCTGAAGAGTTTTGCAGGTGGCGACAAGAAGGCCATCCACCCCAAC
ATTCGCAAGAGCGTCTTTAACGTGTCGCTCAAGTACGGCGGCAAGGAAGAGGTGAGCAAGGGAGATCGTCTCACA
CACTCTTTCAGTCACAATGTCAAAACGCACAAACGATTACTTTTGCTGACGCACAGAACGCGCAAACAGTACGAC
GAGATCCTCGGACTCTATCGGTCCTCGACCAACAGCGACGAGCGCAACACGTGCCTCCGCAGCCTGGGGCGGGCC
AAGGACCCGGAGCTCATCAAGCGGACGCTGGGCCTGGTCTTTAGCGACGAGGTCAAGGACCAGGACAGCTATCTG
CCCATCAGCGGACTGCGGTCGCACCCAGAGGGCATCGAGGCCATGTTTAAGTGGATGAAGGAGAACTGGGAGACC
ATGTACAAGCGGCTGCCGCCGGGGCTGTCGATGCTGGGCACCATGGTGTCGCTCATGACGTCGGGCTTCTCAACG
CAGAAGCAGCTAGACGAGGTGGACCGCTTCTTCGGCGACAAGAACAACAACGGCTACGACCAGGCGCTGGCGCAG
ACCAAGGACGCGATCCGGTCCAAGATATCGTGGCTCGGTCGCGACTCGCAGGACGTGGCGGCCTGGCTCAAGGCC
AAGGGCTACGCCGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail