Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|992
Gene name
LocationContig_127:5552..6097
Strand-
Gene length (bp)545
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11221 Med21 Subunit 21 of Mediator complex 3.2E-43 1 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S8C2|MED21_NEUCR Mediator of RNA polymerase II transcription subunit 21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=srb-7 PE=3 SV=1 1 137 3.0E-46
sp|Q6FNK3|MED21_CANGA Mediator of RNA polymerase II transcription subunit 21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SRB7 PE=3 SV=1 1 132 8.0E-18
sp|A1C712|MED21_ASPCL Mediator of RNA polymerase II transcription subunit 21 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=srb7 PE=3 SV=1 1 120 2.0E-15
sp|O94376|MED21_SCHPO Mediator of RNA polymerase II transcription subunit 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=med21 PE=1 SV=1 1 137 2.0E-15
sp|Q6C5U8|MED21_YARLI Mediator of RNA polymerase II transcription subunit 21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB7 PE=3 SV=1 1 132 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S8C2|MED21_NEUCR Mediator of RNA polymerase II transcription subunit 21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=srb-7 PE=3 SV=1 1 137 3.0E-46
sp|Q6FNK3|MED21_CANGA Mediator of RNA polymerase II transcription subunit 21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SRB7 PE=3 SV=1 1 132 8.0E-18
sp|A1C712|MED21_ASPCL Mediator of RNA polymerase II transcription subunit 21 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=srb7 PE=3 SV=1 1 120 2.0E-15
sp|O94376|MED21_SCHPO Mediator of RNA polymerase II transcription subunit 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=med21 PE=1 SV=1 1 137 2.0E-15
sp|Q6C5U8|MED21_YARLI Mediator of RNA polymerase II transcription subunit 21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB7 PE=3 SV=1 1 132 2.0E-15
sp|Q75EX7|MED21_ASHGO Mediator of RNA polymerase II transcription subunit 21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SRB7 PE=3 SV=2 1 133 1.0E-14
sp|Q2UF93|MED21_ASPOR Mediator of RNA polymerase II transcription subunit 21 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=srb7 PE=3 SV=1 57 135 9.0E-14
sp|Q6BQ63|MED21_DEBHA Mediator of RNA polymerase II transcription subunit 21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SRB7 PE=3 SV=1 1 132 1.0E-13
sp|P47822|MED21_YEAST Mediator of RNA polymerase II transcription subunit 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB7 PE=1 SV=1 1 132 3.0E-13
sp|A2QC41|MED21_ASPNC Mediator of RNA polymerase II transcription subunit 21 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=srb7 PE=3 SV=2 1 108 4.0E-13
sp|A3LS24|MED21_PICST Mediator of RNA polymerase II transcription subunit 21 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SRB7 PE=3 SV=1 1 132 5.0E-13
sp|Q5ACU4|MED21_CANAL Mediator of RNA polymerase II transcription subunit 21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SRB7 PE=3 SV=1 1 135 3.0E-12
sp|Q4X0I5|MED21_ASPFU Mediator of RNA polymerase II transcription subunit 21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=srb7 PE=3 SV=1 53 135 3.0E-12
sp|Q6CT76|MED21_KLULA Mediator of RNA polymerase II transcription subunit 21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SRB7 PE=3 SV=2 1 127 5.0E-12
sp|Q1DXC2|MED21_COCIM Mediator of RNA polymerase II transcription subunit 21 OS=Coccidioides immitis (strain RS) GN=SRB7 PE=3 SV=3 1 103 3.0E-11
sp|A1DHP1|MED21_NEOFI Mediator of RNA polymerase II transcription subunit 21 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=srb7 PE=3 SV=1 53 135 1.0E-09
sp|Q0U499|MED21_PHANO Mediator of RNA polymerase II transcription subunit 21 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SRB7 PE=3 SV=1 1 137 2.0E-09
sp|Q5AZQ7|MED21_EMENI Mediator of RNA polymerase II transcription subunit 21 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=srb7 PE=3 SV=1 61 101 6.0E-08
sp|Q7ZTI5|MED21_DANRE Mediator of RNA polymerase II transcription subunit 21 OS=Danio rerio GN=med21 PE=2 SV=1 1 135 8.0E-06
sp|Q2TBU8|MED21_BOVIN Mediator of RNA polymerase II transcription subunit 21 OS=Bos taurus GN=MED21 PE=2 SV=1 1 135 9.0E-06
sp|Q13503|MED21_HUMAN Mediator of RNA polymerase II transcription subunit 21 OS=Homo sapiens GN=MED21 PE=1 SV=1 1 135 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4312
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|992 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3373
Ophiocordyceps camponoti-floridani Ophcf2|04152
Ophiocordyceps camponoti-rufipedis Ophun1|4050
Ophiocordyceps kimflemingae Ophio5|3009
Ophiocordyceps subramaniannii Hirsu2|8851

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|992
MGDRLTQLQDAVDQLAQQLVACLHFVHRRHDLETLGPKDKVRDIKQEPHQKEVDPLPADDFLAGLRELSRDLIVR
EQQIEYLISSLPGLESSQQDQARLVKDLEEDLKAAEAQRQEALRERDQTLAQLDAVIRSIRRP*
Coding >OphauG2|992
ATGGGTGACAGACTGACGCAGCTACAGGATGCTGTTGATCAGCTTGCTCAGCAGCTTGTCGCCTGCCTCCACTTT
GTCCATCGCCGACACGATCTCGAGACCCTTGGCCCCAAAGACAAGGTTCGCGACATAAAGCAGGAGCCGCATCAG
AAAGAAGTCGACCCGCTTCCTGCAGACGACTTCCTGGCAGGTCTCAGGGAGCTGTCTCGAGACCTGATTGTTCGA
GAGCAACAGATCGAATACCTCATTTCTTCGCTTCCTGGGCTTGAAAGTAGCCAGCAGGATCAGGCACGTCTGGTT
AAAGATCTTGAAGAAGACCTAAAAGCTGCCGAGGCGCAGCGACAGGAAGCACTCAGGGAAAGAGATCAGACTCTG
GCCCAACTTGACGCAGTGATTCGCAGCATCCGACGGCCCTGA
Transcript >OphauG2|992
ATGGGTGACAGACTGACGCAGCTACAGGATGCTGTTGATCAGCTTGCTCAGCAGCTTGTCGCCTGCCTCCACTTT
GTCCATCGCCGACACGATCTCGAGACCCTTGGCCCCAAAGACAAGGTTCGCGACATAAAGCAGGAGCCGCATCAG
AAAGAAGTCGACCCGCTTCCTGCAGACGACTTCCTGGCAGGTCTCAGGGAGCTGTCTCGAGACCTGATTGTTCGA
GAGCAACAGATCGAATACCTCATTTCTTCGCTTCCTGGGCTTGAAAGTAGCCAGCAGGATCAGGCACGTCTGGTT
AAAGATCTTGAAGAAGACCTAAAAGCTGCCGAGGCGCAGCGACAGGAAGCACTCAGGGAAAGAGATCAGACTCTG
GCCCAACTTGACGCAGTGATTCGCAGCATCCGACGGCCCTGA
Gene >OphauG2|992
ATGGGTGACAGACTGACGCAGCTACAGGATGCTGTTGATCAGGCATGTCTCTGTCTCTACGTGTGCAGCTGCTTT
CTCGAGATGCTAATGGCCTGCGTCTGCAGCTTGCTCAGCAGCTTGTCGCCTGCCTCCACTTTGTCCATCGCCGAC
ACGATCTCGAGACCCTTGGCCCCAAAGACAAGGTTCGCGACATAAAGCAGGAGCCGCATCAGAAAGAAGGTGAGC
TTGTTCTTTGATAAGAGCTTTGCACATCCATAGCATCGCTTTACTCATGGCAGGGCACAGTCGACCCGCTTCCTG
CAGACGACTTCCTGGCAGGTCTCAGGGAGCTGTCTCGAGACCTGATTGTTCGAGAGCAACAGATCGAATACCTCA
TTTCTTCGCTTCCTGGGCTTGAAAGTAGCCAGCAGGATCAGGCACGTCTGGTTAAAGATCTTGAAGAAGACCTAA
AAGCTGCCGAGGCGCAGCGACAGGAAGCACTCAGGGAAAGAGATCAGACTCTGGCCCAACTTGACGCAGTGATTC
GCAGCATCCGACGGCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail