Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|99
Gene name
LocationContig_1005:243..2585
Strand-
Gene length (bp)2342
Transcript length (bp)2244
Coding sequence length (bp)2244
Protein length (aa) 748

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4944
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|99 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5603
Ophiocordyceps camponoti-floridani Ophcf2|00926
Ophiocordyceps kimflemingae Ophio5|4568
Ophiocordyceps subramaniannii Hirsu2|1857

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|99
MACSSDGLSHDLGPGAAPEPASASAPASPLTSLQATGLEPPAATTVARPNSAPLPMAPAAHESVAAECSAAPPLP
LVTAPTAALASSAPPSTPRPKPYLAVDTAAADTAPPSATANHQEQTTTIMDAAPQTAQPDAPATQHQTTTSPAAP
YTPAPMARFDQAYAMMATLASIAGARGPIGMTPPPTVTPAQVTLPSYSAQDEFGAPGHANGLRLPNADPSLESFA
RVEFADSVFQMTTYAVIIGRDQRALMQARRDERQAQEHRRRTQEYALQGLPPPSPIHGERSKFSKSYVSEEGGML
GPESDSEDNGNARPSKRRKPSTTGSSQNGNQEDPDKMIFNRQYVSHTPGAAAVDLRSLRPSPFHVPFIGIHSPGP
NIASKTKAISREHLKIVYNPAQGVFEAIPLHKNGFFCQDVHYNTEKVVLRCGDRLQIKDIDFRFIINGVERGCTG
AEESEDDEAAAATKTHTHGGKEMSFEFEASHGNGAIQDTSDELSELDASPPELSDFEGLGNGNDDDDDDDDDDDD
DEDQDMNDAVEQGRTTGTEPEGKDHGKAGLQEGQRVAPGMADAPIPYQARKRGPGRPPKNGFMSKREQRLLKKAQ
LEMEKMKVSQTPAEQPVKRKVGRPRKHPLPDQGSERPEKRRYKPRKPKGEEGADGASDGERRAKEKKDRRARPKS
PALDLKIEDYSEEQLQKPNKNYGVLIDETLTAAGPDGLTLKQIYKRICQRYPWFFFHTETKGWESKAQGDDA*
Coding >OphauG2|99
ATGGCGTGTTCCAGCGATGGCCTCAGCCATGACCTTGGCCCTGGTGCAGCGCCAGAGCCTGCTTCAGCCTCGGCT
CCTGCTTCTCCGCTAACGTCTCTGCAAGCTACTGGTCTTGAACCGCCTGCTGCGACCACTGTCGCGAGGCCAAAC
TCTGCTCCGCTGCCAATGGCGCCCGCCGCTCATGAGAGCGTGGCTGCCGAATGCTCGGCTGCGCCTCCTTTGCCT
CTTGTCACTGCTCCTACGGCGGCGCTTGCAAGCTCTGCTCCGCCGTCGACTCCACGGCCAAAGCCATATCTTGCT
GTCGACACTGCTGCCGCCGACACTGCTCCCCCATCTGCCACTGCCAACCATCAAGAACAAACGACAACAATCATG
GACGCTGCGCCTCAGACTGCCCAGCCAGACGCTCCAGCTACCCAACACCAAACGACTACATCCCCTGCTGCGCCA
TATACTCCCGCCCCCATGGCTCGGTTCGACCAGGCCTACGCCATGATGGCCACGCTGGCCTCTATAGCTGGGGCA
CGAGGCCCTATTGGCATGACACCTCCCCCAACCGTGACGCCTGCGCAGGTGACACTGCCATCATACTCGGCACAA
GACGAGTTTGGCGCTCCGGGCCACGCCAACGGCCTTCGTCTCCCCAATGCCGACCCTTCCCTCGAGTCGTTTGCC
CGCGTCGAGTTTGCCGACAGCGTCTTCCAAATGACGACATACGCCGTCATCATCGGCCGCGATCAACGCGCTCTT
ATGCAGGCGCGCCGCGACGAGAGACAGGCCCAAGAGCACAGACGGCGCACCCAAGAATATGCCCTCCAGGGCCTG
CCCCCTCCATCACCCATTCATGGCGAGCGCAGTAAATTTAGTAAATCCTACGTGAGCGAAGAAGGCGGTATGTTG
GGCCCAGAGTCTGATAGTGAGGATAATGGCAACGCCCGCCCCTCTAAACGCCGCAAGCCAAGCACCACGGGCTCG
TCGCAAAACGGCAACCAAGAGGACCCCGACAAGATGATTTTCAACCGCCAGTACGTGTCGCATACTCCTGGCGCT
GCTGCCGTCGACCTGCGCTCTCTACGGCCCTCGCCCTTTCACGTCCCCTTTATCGGCATCCATTCCCCCGGGCCC
AATATTGCCAGCAAGACAAAGGCCATATCTCGAGAGCATCTCAAGATTGTCTACAACCCAGCCCAAGGTGTCTTT
GAGGCCATTCCTCTGCACAAGAATGGCTTCTTTTGCCAAGACGTGCACTACAATACCGAAAAGGTGGTTCTCAGG
TGTGGCGACCGCCTCCAAATCAAGGATATCGATTTTCGCTTCATTATTAATGGCGTCGAGCGTGGCTGCACCGGC
GCCGAGGAGTCTGAAGATGATGAAGCTGCTGCCGCCACCAAGACTCACACGCATGGGGGCAAGGAAATGAGCTTT
GAGTTTGAGGCGTCTCATGGCAATGGAGCCATTCAGGACACCAGTGATGAACTGTCTGAACTCGATGCCAGTCCT
CCAGAGCTGTCTGATTTTGAGGGGCTTGGCAATGGCAATGACGATGATGATGATGATGATGATGACGACGACGAC
GACGAGGATCAAGACATGAATGACGCTGTCGAGCAAGGACGCACGACGGGCACAGAGCCCGAGGGCAAGGACCAT
GGCAAGGCCGGCCTGCAAGAGGGACAGCGTGTGGCTCCAGGAATGGCAGATGCACCGATTCCGTACCAGGCCAGG
AAGAGAGGGCCAGGCCGGCCGCCCAAAAACGGCTTCATGTCCAAGAGGGAGCAGCGCCTGCTCAAAAAGGCGCAG
CTTGAGATGGAAAAGATGAAGGTATCGCAGACGCCGGCCGAGCAGCCAGTCAAGCGCAAGGTTGGCAGGCCTAGA
AAACACCCGCTGCCAGACCAAGGCAGCGAGCGGCCAGAGAAGCGCAGATACAAGCCGCGCAAGCCAAAGGGCGAA
GAAGGGGCCGACGGCGCGTCGGACGGGGAGCGGCGAGCCAAGGAGAAGAAGGACAGGCGAGCGCGGCCCAAGTCG
CCGGCGCTGGACCTCAAGATTGAAGACTACAGCGAGGAGCAGCTGCAAAAGCCCAACAAGAACTACGGCGTCTTG
ATTGACGAGACGCTGACGGCAGCCGGGCCTGACGGCTTGACTCTTAAGCAGATTTACAAGAGGATATGCCAGCGA
TACCCCTGGTTCTTCTTCCACACCGAGACCAAGGGCTGGGAGAGCAAAGCGCAAGGCGACGACGCCTGA
Transcript >OphauG2|99
ATGGCGTGTTCCAGCGATGGCCTCAGCCATGACCTTGGCCCTGGTGCAGCGCCAGAGCCTGCTTCAGCCTCGGCT
CCTGCTTCTCCGCTAACGTCTCTGCAAGCTACTGGTCTTGAACCGCCTGCTGCGACCACTGTCGCGAGGCCAAAC
TCTGCTCCGCTGCCAATGGCGCCCGCCGCTCATGAGAGCGTGGCTGCCGAATGCTCGGCTGCGCCTCCTTTGCCT
CTTGTCACTGCTCCTACGGCGGCGCTTGCAAGCTCTGCTCCGCCGTCGACTCCACGGCCAAAGCCATATCTTGCT
GTCGACACTGCTGCCGCCGACACTGCTCCCCCATCTGCCACTGCCAACCATCAAGAACAAACGACAACAATCATG
GACGCTGCGCCTCAGACTGCCCAGCCAGACGCTCCAGCTACCCAACACCAAACGACTACATCCCCTGCTGCGCCA
TATACTCCCGCCCCCATGGCTCGGTTCGACCAGGCCTACGCCATGATGGCCACGCTGGCCTCTATAGCTGGGGCA
CGAGGCCCTATTGGCATGACACCTCCCCCAACCGTGACGCCTGCGCAGGTGACACTGCCATCATACTCGGCACAA
GACGAGTTTGGCGCTCCGGGCCACGCCAACGGCCTTCGTCTCCCCAATGCCGACCCTTCCCTCGAGTCGTTTGCC
CGCGTCGAGTTTGCCGACAGCGTCTTCCAAATGACGACATACGCCGTCATCATCGGCCGCGATCAACGCGCTCTT
ATGCAGGCGCGCCGCGACGAGAGACAGGCCCAAGAGCACAGACGGCGCACCCAAGAATATGCCCTCCAGGGCCTG
CCCCCTCCATCACCCATTCATGGCGAGCGCAGTAAATTTAGTAAATCCTACGTGAGCGAAGAAGGCGGTATGTTG
GGCCCAGAGTCTGATAGTGAGGATAATGGCAACGCCCGCCCCTCTAAACGCCGCAAGCCAAGCACCACGGGCTCG
TCGCAAAACGGCAACCAAGAGGACCCCGACAAGATGATTTTCAACCGCCAGTACGTGTCGCATACTCCTGGCGCT
GCTGCCGTCGACCTGCGCTCTCTACGGCCCTCGCCCTTTCACGTCCCCTTTATCGGCATCCATTCCCCCGGGCCC
AATATTGCCAGCAAGACAAAGGCCATATCTCGAGAGCATCTCAAGATTGTCTACAACCCAGCCCAAGGTGTCTTT
GAGGCCATTCCTCTGCACAAGAATGGCTTCTTTTGCCAAGACGTGCACTACAATACCGAAAAGGTGGTTCTCAGG
TGTGGCGACCGCCTCCAAATCAAGGATATCGATTTTCGCTTCATTATTAATGGCGTCGAGCGTGGCTGCACCGGC
GCCGAGGAGTCTGAAGATGATGAAGCTGCTGCCGCCACCAAGACTCACACGCATGGGGGCAAGGAAATGAGCTTT
GAGTTTGAGGCGTCTCATGGCAATGGAGCCATTCAGGACACCAGTGATGAACTGTCTGAACTCGATGCCAGTCCT
CCAGAGCTGTCTGATTTTGAGGGGCTTGGCAATGGCAATGACGATGATGATGATGATGATGATGACGACGACGAC
GACGAGGATCAAGACATGAATGACGCTGTCGAGCAAGGACGCACGACGGGCACAGAGCCCGAGGGCAAGGACCAT
GGCAAGGCCGGCCTGCAAGAGGGACAGCGTGTGGCTCCAGGAATGGCAGATGCACCGATTCCGTACCAGGCCAGG
AAGAGAGGGCCAGGCCGGCCGCCCAAAAACGGCTTCATGTCCAAGAGGGAGCAGCGCCTGCTCAAAAAGGCGCAG
CTTGAGATGGAAAAGATGAAGGTATCGCAGACGCCGGCCGAGCAGCCAGTCAAGCGCAAGGTTGGCAGGCCTAGA
AAACACCCGCTGCCAGACCAAGGCAGCGAGCGGCCAGAGAAGCGCAGATACAAGCCGCGCAAGCCAAAGGGCGAA
GAAGGGGCCGACGGCGCGTCGGACGGGGAGCGGCGAGCCAAGGAGAAGAAGGACAGGCGAGCGCGGCCCAAGTCG
CCGGCGCTGGACCTCAAGATTGAAGACTACAGCGAGGAGCAGCTGCAAAAGCCCAACAAGAACTACGGCGTCTTG
ATTGACGAGACGCTGACGGCAGCCGGGCCTGACGGCTTGACTCTTAAGCAGATTTACAAGAGGATATGCCAGCGA
TACCCCTGGTTCTTCTTCCACACCGAGACCAAGGGCTGGGAGAGCAAAGCGCAAGGCGACGACGCCTGA
Gene >OphauG2|99
ATGGCGTGTTCCAGCGATGGCCTCAGCCATGACCTTGGCCCTGGTGCAGCGCCAGAGCCTGCTTCAGCCTCGGCT
CCTGCTTCTCCGCTAACGTCTCTGCAAGCTACTGGTCTTGAACCGCCTGCTGCGACCACTGTCGCGAGGCCAAAC
TCTGCTCCGCTGCCAATGGCGCCCGCCGCTCATGAGAGCGTGGCTGCCGAATGCTCGGCTGCGCCTCCTTTGCCT
CTTGTCACTGCTCCTACGGCGGCGCTTGCAAGCTCTGCTCCGCCGTCGACTCCACGGCCAAAGCCATATCTTGCT
GTCGACACTGCTGCCGCCGACACTGCTCCCCCATCTGCCACTGCCAACCATCAAGAACAAACGACAACAATCATG
GACGCTGCGCCTCAGACTGCCCAGCCAGACGCTCCAGCTACCCAACACCAAACGACTACATCCCCTGCTGCGCCA
TATACTCCCGCCCCCATGGCTCGGTTCGACCAGGCCTACGCCATGATGGCCACGCTGGCCTCTATAGCTGGGGCA
CGAGGCCCTATTGGCATGACACCTCCCCCAACCGTGACGCCTGCGCAGGTGACACTGCCATCATACTCGGCACAA
GACGAGTTTGGCGCTCCGGGCCACGCCAACGGCCTTCGTCTCCCCAATGCCGACCCTTCCCTCGAGTCGTTTGCC
CGCGTCGAGTTTGCCGACAGCGTCTTCCAAATGACGACATACGCCGTCATCATCGGCCGCGATCAACGCGCTCTT
ATGCAGGCGCGCCGCGACGAGAGACAGGCCCAAGAGCACAGACGGCGCACCCAAGAATATGCCCTCCAGGGCCTG
CCCCCTCCATCACCCATTCATGGCGAGCGCAGTAAATTTAGTAAATCCTACGTGAGCGAAGAAGGCGGTATGTTG
GGCCCAGAGTCTGATAGTGAGGATAATGGCAACGCCCGCCCCTCTAAACGCCGCAAGCCAAGCACCACGGGCTCG
TCGCAAAACGGCAACCAAGAGGACCCCGACAAGATGATTTTCAACCGCCAGTACGTGTCGCATACTCCTGGCGCT
GCTGCCGTCGACCTGCGCTCTCTACGGCCCTCGCCCTTTCACGTCCCCTTTATCGGCATCCATTCCCCCGGGCCC
AATATTGCCAGCAAGACAAAGGCCATATCTCGAGAGCATCTCAAGATTGTCTACAACCCAGCCCAAGGTGTCTTT
GAGGCCATTCCTCTGCACAAGAATGGCTTCTTTTGCCAAGACGTGCACTACAATACCGAAAAGGTGGTTCTCAGG
TGTGGCGACCGCCTCCAAATCAAGGATATCGATTTTCGCTTCATTATTAATGGCGTCGAGCGTGGCTGCACCGGC
GCCGAGGAGTCTGAAGATGATGAAGCTGCTGCCGCCACCAAGACTCACACGCATGGGGGCAAGGAAATGAGCTTT
GAGTTTGAGGCGTCTCATGGCAATGGAGCCATTCAGGACACCAGTGATGAACTGTCTGAACTCGATGCCAGTCCT
CCAGAGCTGTCTGATTTTGAGGGGCTTGGCAATGGCAATGACGATGATGATGATGATGATGATGACGACGACGAC
GACGAGGATCAAGACATGAATGACGCTGTCGAGCAAGGACGCACGACGGGCACAGAGCCCGAGGGCAAGGACCAT
GGCAAGGCCGGCCTGCAAGAGGGACAGCGTGTGGCTCCAGGAATGGCAGATGCACCGATTCCGTACCAGGCCAGG
AAGAGAGGGCCAGGCCGGCCGCCCAAAAACGGCTTCATGTCCAAGAGGGAGCAGCGCCTGCTCAAAAAGGCGCAG
CTTGAGATGGAAAAGATGAAGGTATCGCAGACGCCGGCCGAGCAGCCAGTCAAGCGCAAGGTTGGCAGGCCTAGA
AAACACCCGCTGCCAGACCAAGGCAGCGAGCGGCCAGAGAAGCGCAGATACAAGCCGCGCAAGCCAAAGGGCGAA
GAAGGGGCCGACGGCGCGTCGGACGGGGAGCGGCGAGCCAAGGAGAAGAAGGACAGGCGAGCGCGGCCCAAGTCG
CCGGCGCTGGACCTCAAGATTGAAGACTACAGCGAGGAGCAGCTGCAAAAGCCCAACAAGAACTACGGCGTCTTG
ATTGACGAGACGCTGACGGCAGCCGGGCCTGACGGCTTGACTCTTAAGCAGATTTACAAGAGGATATGCCAGCGA
TACCCCTGGTTCTTCTTCCACACCGAGACCAAGGGCTGGGAGAGCAGTGTGCGGCACAATCTTATTGGCAACGAG
GCCTTTAAGAAGGACGAGACGACGAATCTCTGGGCGCGCGTGCCGGGCGTTGAGCTGGATGCGGGCAAGAAGCGC
AAGGCGACGACGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail