Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|982
Gene name
LocationContig_1263:4099..4761
Strand-
Gene length (bp)662
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5056
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|982 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2800
Ophiocordyceps camponoti-floridani Ophcf2|02410
Ophiocordyceps camponoti-rufipedis Ophun1|6753
Ophiocordyceps kimflemingae Ophio5|4510
Ophiocordyceps subramaniannii Hirsu2|276

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|982
MPSGRSSGSSSKSSKSDRAHVSSSVQQLIDCLTTHRVNTLTELCRIERMAASCTDEADARAFQKPMTAAWAHYVS
SHQLLTELRGLTRAYPFSGDVVREAYRRVRADPASNRSWNLAWLCLRRIRDDGLIAVYAGAEAARPDMWAGHVPA
KDDVERLRACFEREWATAVDTMLRHWQCPPTWY*
Coding >OphauG2|982
ATGCCTTCTGGAAGAAGCAGTGGCAGCAGCTCCAAGAGCAGCAAGTCTGACAGGGCTCATGTCAGTTCGTCTGTC
CAACAGCTCATTGACTGCCTGACAACACACCGCGTCAACACGCTGACGGAACTATGCCGGATTGAACGCATGGCG
GCGTCGTGCACCGACGAAGCGGACGCGCGCGCCTTTCAGAAGCCCATGACGGCCGCGTGGGCACACTACGTCTCG
TCGCATCAGCTCTTGACGGAGCTGCGCGGCCTGACGCGCGCATACCCCTTTTCCGGCGACGTGGTGCGCGAGGCG
TACCGCCGCGTGCGCGCCGACCCGGCCAGCAACCGCAGCTGGAACCTGGCCTGGCTGTGTCTGCGCCGCATCCGC
GACGATGGCTTGATTGCTGTGTATGCTGGCGCAGAGGCGGCCAGGCCTGATATGTGGGCGGGCCATGTCCCGGCA
AAGGACGATGTCGAGAGGTTGAGGGCCTGCTTTGAGAGGGAGTGGGCAACGGCCGTGGATACAATGCTGAGGCAT
TGGCAGTGTCCGCCGACGTGGTATTGA
Transcript >OphauG2|982
ATGCCTTCTGGAAGAAGCAGTGGCAGCAGCTCCAAGAGCAGCAAGTCTGACAGGGCTCATGTCAGTTCGTCTGTC
CAACAGCTCATTGACTGCCTGACAACACACCGCGTCAACACGCTGACGGAACTATGCCGGATTGAACGCATGGCG
GCGTCGTGCACCGACGAAGCGGACGCGCGCGCCTTTCAGAAGCCCATGACGGCCGCGTGGGCACACTACGTCTCG
TCGCATCAGCTCTTGACGGAGCTGCGCGGCCTGACGCGCGCATACCCCTTTTCCGGCGACGTGGTGCGCGAGGCG
TACCGCCGCGTGCGCGCCGACCCGGCCAGCAACCGCAGCTGGAACCTGGCCTGGCTGTGTCTGCGCCGCATCCGC
GACGATGGCTTGATTGCTGTGTATGCTGGCGCAGAGGCGGCCAGGCCTGATATGTGGGCGGGCCATGTCCCGGCA
AAGGACGATGTCGAGAGGTTGAGGGCCTGCTTTGAGAGGGAGTGGGCAACGGCCGTGGATACAATGCTGAGGCAT
TGGCAGTGTCCGCCGACGTGGTATTGA
Gene >OphauG2|982
ATGCCTTCTGGAAGAAGCAGTGGCAGCAGCTCCAAGAGCAGCAAGTCTGACAGGGCTCATGTCAGTGTAAGTCTA
GCTCTCAAGAGTGTCGCCGTGTCGGCGTGGCAGATTTAAGATTTGGGAGAAGTGAAAATTAGGGAGAGAGACGAG
ACAAGCTAACGAGCAAGCGCACACAGTCGTCTGTCCAACAGCTCATTGACTGCCTGACAACACACCGCGTCAACA
CGCTGACGGAACTATGCCGGATTGAACGCATGGCGGCGTCGTGCACCGACGAAGCGGACGCGCGCGCCTTTCAGA
AGCCCATGACGGCCGCGTGGGCACACTACGTCTCGTCGCATCAGCTCTTGACGGAGCTGCGCGGCCTGACGCGCG
CATACCCCTTTTCCGGCGACGTGGTGCGCGAGGCGTACCGCCGCGTGCGCGCCGACCCGGCCAGCAACCGCAGCT
GGAACCTGGCCTGGCTGTGTCTGCGCCGCATCCGCGACGATGGCTTGATTGCTGTGTATGCTGGCGCAGAGGCGG
CCAGGCCTGATATGTGGGCGGGCCATGTCCCGGCAAAGGACGATGTCGAGAGGTTGAGGGCCTGCTTTGAGAGGG
AGTGGGCAACGGCCGTGGATACAATGCTGAGGCATTGGCAGTGTCCGCCGACGTGGTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail