Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|971
Gene name
LocationContig_126:22633..23678
Strand+
Gene length (bp)1045
Transcript length (bp)990
Coding sequence length (bp)990
Protein length (aa) 330

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13622 4HBT_3 Thioesterase-like superfamily 7.5E-44 31 310

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup752
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|971 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7292
Ophiocordyceps camponoti-floridani Ophcf2|01300
Ophiocordyceps camponoti-rufipedis Ophun1|2654
Ophiocordyceps kimflemingae Ophio5|2780
Ophiocordyceps kimflemingae Ophio5|6509
Ophiocordyceps subramaniannii Hirsu2|2211
Ophiocordyceps subramaniannii Hirsu2|7132

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|971
MFSGEEKAASLEEKTRVSRLDEFTYAAELSEAFCVGIVPNGGYVASIFLRAARQHAALLGQPDAIAVHWQFLAKT
RAGRAVLRIDEVRRSKAMSVLHVSLFQGKLQQQAPWVSGSSEACVVAYITCRDIALESGLSLPTNWSPSPAPPPA
DLANLPRKLAGDKWRPFWARVMDFVTPLRSLEFYYPADAHALDPHQHLDFWVRLSQPNARFCETDLGFLADAAAP
LLIESYRPGKENETPAPYFPRHKAFWYPTVTMSLDVKKKLPPDGAEWLRLHTAAKVIRNGRLDSEVIVFDSEGDV
VALSHHVAMIVDVERNFASQQGEKSKSNL*
Coding >OphauG2|971
ATGTTTAGTGGCGAGGAAAAGGCGGCGTCGCTGGAGGAAAAGACGCGTGTTTCGCGGCTCGATGAATTCACATAT
GCGGCCGAGCTGTCAGAGGCATTCTGCGTGGGCATTGTGCCCAATGGGGGATATGTTGCCTCCATCTTTCTCCGC
GCAGCAAGACAACACGCGGCATTGCTTGGACAGCCAGACGCGATAGCTGTGCACTGGCAGTTTTTGGCAAAGACT
AGGGCTGGGCGGGCCGTGCTGCGTATCGACGAGGTTCGCAGATCAAAGGCCATGTCGGTGTTGCATGTGTCCTTG
TTTCAGGGCAAGCTGCAACAACAGGCGCCGTGGGTGTCTGGGTCGAGTGAAGCTTGCGTGGTGGCGTATATTACG
TGTCGCGATATTGCGTTGGAGTCTGGATTGTCGCTGCCGACAAACTGGTCGCCGTCTCCTGCGCCTCCGCCAGCA
GACTTGGCGAATCTGCCAAGGAAGCTTGCTGGCGACAAATGGCGTCCGTTTTGGGCGCGCGTCATGGATTTCGTA
ACGCCGTTGAGGAGCCTGGAGTTTTATTATCCGGCTGATGCCCATGCTCTTGATCCCCATCAGCATCTCGACTTT
TGGGTGCGTCTTTCTCAGCCGAATGCTCGCTTCTGCGAAACCGACTTGGGATTCCTTGCTGATGCCGCCGCTCCG
CTGCTCATCGAGTCCTATCGTCCCGGCAAGGAGAATGAGACGCCAGCGCCGTATTTCCCTCGCCACAAGGCCTTT
TGGTATCCGACAGTTACCATGAGCCTTGATGTCAAGAAGAAACTACCGCCTGATGGAGCCGAGTGGCTGCGTCTT
CACACGGCGGCAAAAGTCATTCGCAACGGCCGGCTCGACTCCGAGGTCATTGTGTTTGACAGCGAGGGAGATGTG
GTTGCCTTGAGCCACCACGTTGCCATGATTGTCGACGTGGAGCGCAACTTTGCTTCGCAGCAAGGAGAAAAGAGC
AAAAGCAACCTGTAG
Transcript >OphauG2|971
ATGTTTAGTGGCGAGGAAAAGGCGGCGTCGCTGGAGGAAAAGACGCGTGTTTCGCGGCTCGATGAATTCACATAT
GCGGCCGAGCTGTCAGAGGCATTCTGCGTGGGCATTGTGCCCAATGGGGGATATGTTGCCTCCATCTTTCTCCGC
GCAGCAAGACAACACGCGGCATTGCTTGGACAGCCAGACGCGATAGCTGTGCACTGGCAGTTTTTGGCAAAGACT
AGGGCTGGGCGGGCCGTGCTGCGTATCGACGAGGTTCGCAGATCAAAGGCCATGTCGGTGTTGCATGTGTCCTTG
TTTCAGGGCAAGCTGCAACAACAGGCGCCGTGGGTGTCTGGGTCGAGTGAAGCTTGCGTGGTGGCGTATATTACG
TGTCGCGATATTGCGTTGGAGTCTGGATTGTCGCTGCCGACAAACTGGTCGCCGTCTCCTGCGCCTCCGCCAGCA
GACTTGGCGAATCTGCCAAGGAAGCTTGCTGGCGACAAATGGCGTCCGTTTTGGGCGCGCGTCATGGATTTCGTA
ACGCCGTTGAGGAGCCTGGAGTTTTATTATCCGGCTGATGCCCATGCTCTTGATCCCCATCAGCATCTCGACTTT
TGGGTGCGTCTTTCTCAGCCGAATGCTCGCTTCTGCGAAACCGACTTGGGATTCCTTGCTGATGCCGCCGCTCCG
CTGCTCATCGAGTCCTATCGTCCCGGCAAGGAGAATGAGACGCCAGCGCCGTATTTCCCTCGCCACAAGGCCTTT
TGGTATCCGACAGTTACCATGAGCCTTGATGTCAAGAAGAAACTACCGCCTGATGGAGCCGAGTGGCTGCGTCTT
CACACGGCGGCAAAAGTCATTCGCAACGGCCGGCTCGACTCCGAGGTCATTGTGTTTGACAGCGAGGGAGATGTG
GTTGCCTTGAGCCACCACGTTGCCATGATTGTCGACGTGGAGCGCAACTTTGCTTCGCAGCAAGGAGAAAAGAGC
AAAAGCAACCTGTAG
Gene >OphauG2|971
ATGTTTAGTGGCGAGGAAAAGGCGGCGTCGCTGGAGGAAAAGACGCGTGTTTCGCGGCTCGATGAATTCACATAT
GCGGCCGAGCTGTCAGAGGCATTCTGCGTGGGCATTGGCATGTCTGCTGCATCTTTGCGAGTTGAAATGCGAGCT
AATCGACGTCCATCTAGTGCCCAATGGGGGATATGTTGCCTCCATCTTTCTCCGCGCAGCAAGACAACACGCGGC
ATTGCTTGGACAGCCAGACGCGATAGCTGTGCACTGGCAGTTTTTGGCAAAGACTAGGGCTGGGCGGGCCGTGCT
GCGTATCGACGAGGTTCGCAGATCAAAGGCCATGTCGGTGTTGCATGTGTCCTTGTTTCAGGGCAAGCTGCAACA
ACAGGCGCCGTGGGTGTCTGGGTCGAGTGAAGCTTGCGTGGTGGCGTATATTACGTGTCGCGATATTGCGTTGGA
GTCTGGATTGTCGCTGCCGACAAACTGGTCGCCGTCTCCTGCGCCTCCGCCAGCAGACTTGGCGAATCTGCCAAG
GAAGCTTGCTGGCGACAAATGGCGTCCGTTTTGGGCGCGCGTCATGGATTTCGTAACGCCGTTGAGGAGCCTGGA
GTTTTATTATCCGGCTGATGCCCATGCTCTTGATCCCCATCAGCATCTCGACTTTTGGGTGCGTCTTTCTCAGCC
GAATGCTCGCTTCTGCGAAACCGACTTGGGATTCCTTGCTGATGCCGCCGCTCCGCTGCTCATCGAGTCCTATCG
TCCCGGCAAGGAGAATGAGACGCCAGCGCCGTATTTCCCTCGCCACAAGGCCTTTTGGTATCCGACAGTTACCAT
GAGCCTTGATGTCAAGAAGAAACTACCGCCTGATGGAGCCGAGTGGCTGCGTCTTCACACGGCGGCAAAAGTCAT
TCGCAACGGCCGGCTCGACTCCGAGGTCATTGTGTTTGACAGCGAGGGAGATGTGGTTGCCTTGAGCCACCACGT
TGCCATGATTGTCGACGTGGAGCGCAACTTTGCTTCGCAGCAAGGAGAAAAGAGCAAAAGCAACCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail