Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|960
Gene name
LocationContig_1259:543..1477
Strand+
Gene length (bp)934
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5166
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|960 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5094
Ophiocordyceps camponoti-floridani Ophcf2|05889
Ophiocordyceps camponoti-rufipedis Ophun1|384
Ophiocordyceps kimflemingae Ophio5|1505
Ophiocordyceps subramaniannii Hirsu2|3740

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|960
MAVTLPQVEPVALKVKPELQAKSADINVTNDYGTPNLLFLYYVPFLPDDKKLDLDAIQDEFQTWSAWELGQAETQ
LMKHVEGGRLPSDDSIASRVLRNNYRSKAIAYFRETSEAWLSSISQNLVEKSVPTTPDNINGAILSVLRTLHLEQ
QLQIPFRVVLNTISGTVDLDKESKYFFTHVFYQYNHQSRTFQPIVLDTTFTFVNPADAQGESSKPNLTLQVNFAV
SKYQFDRNLWRRVRHEGEEAIEMGRSILKDMSFDFYVTSPVLEQ*
Coding >OphauG2|960
ATGGCCGTGACCCTCCCACAAGTAGAGCCCGTAGCCCTCAAGGTGAAGCCCGAGCTGCAAGCCAAATCTGCCGAC
ATAAACGTCACCAATGACTATGGCACCCCCAACCTGCTTTTTCTTTACTACGTCCCCTTTCTCCCTGATGACAAG
AAGCTGGACCTTGATGCCATTCAAGACGAGTTTCAGACCTGGAGCGCTTGGGAGCTCGGACAGGCAGAGACCCAA
CTCATGAAGCATGTTGAAGGCGGCAGACTTCCCTCTGACGACTCGATTGCCTCTCGCGTCCTCAGAAACAACTAT
CGCTCCAAGGCCATTGCTTACTTCAGGGAGACTAGTGAAGCATGGCTCAGCAGCATAAGCCAAAATCTCGTTGAA
AAATCTGTTCCAACAACTCCTGATAATATCAATGGCGCTATTCTCTCAGTCCTAAGGACGCTCCACCTGGAGCAG
CAACTCCAAATCCCATTCAGGGTCGTGCTCAACACCATCAGCGGCACTGTTGATCTGGACAAGGAGAGCAAATAT
TTCTTCACTCACGTCTTCTATCAATACAATCACCAATCCAGAACCTTTCAGCCAATCGTTCTCGATACCACCTTT
ACCTTTGTAAACCCAGCAGACGCGCAAGGCGAGAGCAGCAAGCCAAACTTGACTCTCCAGGTCAATTTTGCCGTG
TCAAAATACCAATTTGACAGAAACTTGTGGAGGCGAGTGCGCCACGAAGGAGAAGAAGCCATTGAGATGGGGCGG
TCTATTCTCAAGGATATGTCCTTTGACTTTTATGTGACAAGCCCAGTCCTTGAGCAGTAG
Transcript >OphauG2|960
ATGGCCGTGACCCTCCCACAAGTAGAGCCCGTAGCCCTCAAGGTGAAGCCCGAGCTGCAAGCCAAATCTGCCGAC
ATAAACGTCACCAATGACTATGGCACCCCCAACCTGCTTTTTCTTTACTACGTCCCCTTTCTCCCTGATGACAAG
AAGCTGGACCTTGATGCCATTCAAGACGAGTTTCAGACCTGGAGCGCTTGGGAGCTCGGACAGGCAGAGACCCAA
CTCATGAAGCATGTTGAAGGCGGCAGACTTCCCTCTGACGACTCGATTGCCTCTCGCGTCCTCAGAAACAACTAT
CGCTCCAAGGCCATTGCTTACTTCAGGGAGACTAGTGAAGCATGGCTCAGCAGCATAAGCCAAAATCTCGTTGAA
AAATCTGTTCCAACAACTCCTGATAATATCAATGGCGCTATTCTCTCAGTCCTAAGGACGCTCCACCTGGAGCAG
CAACTCCAAATCCCATTCAGGGTCGTGCTCAACACCATCAGCGGCACTGTTGATCTGGACAAGGAGAGCAAATAT
TTCTTCACTCACGTCTTCTATCAATACAATCACCAATCCAGAACCTTTCAGCCAATCGTTCTCGATACCACCTTT
ACCTTTGTAAACCCAGCAGACGCGCAAGGCGAGAGCAGCAAGCCAAACTTGACTCTCCAGGTCAATTTTGCCGTG
TCAAAATACCAATTTGACAGAAACTTGTGGAGGCGAGTGCGCCACGAAGGAGAAGAAGCCATTGAGATGGGGCGG
TCTATTCTCAAGGATATGTCCTTTGACTTTTATGTGACAAGCCCAGTCCTTGAGCAGTAG
Gene >OphauG2|960
ATGGCCGTGACCCTCCCACAAGTAGAGCCCGTAGCCCTCAAGGTGAAGCCCGAGCTGCAAGCCAAATCTGCCGAC
ATAAACGTCACCAATGACTATGGCACCCCCAACCTGCTTTTTCTTTACTACGTCCCCTTTCTCCCTGATGACAAG
AAGCTGGACCTTGATGCCATTCAAGACGAGTTTCAGACCTGGAGCGCTTGGGAGCTCGGACAGGCAGAGACCCAA
CTCATGAAGCATGTTGAAGGCGGCAGACTTCCCTCTGACGACTCGATTGCCTCTCGCGTCCTCAGAAACAACTAT
CGCTCCAAGGCCATTGCTTACTTCAGGGAGACTAGTGAAGCATGGTGTGTTTTCAAAGACTCAGCCCAAGACTCA
TGCCCGTCTCTGCTAATCGCTCACAACTCTTCAGGCTCAGCAGCATAAGCCAAAATCTCGTTGAAAAATCTGTTC
CAACAACTCCTGATAATATCAATGGCGCTATTCTCTCAGTCCTAAGGACGCTCCACCTGGAGCAGCAACTCCAAA
TCCCATTCAGGGTCGTGCTCAACACCATCAGCGGCACTGTTGATCTGGACAAGGAGAGCAAATATTTCTTCACTC
ACGTCTTCTATCAATACAATCACCAATCCAGAACCTTTCAGCCAAGTAAAATCCCCAGACACCATGGCATCATGG
CACCATGGCCACCACTGACTCGCTTCTAGTCGTTCTCGATACCACCTTTACCTTTGTAAACCCAGCAGACGCGCA
AGGCGAGAGCAGCAAGCCAAACTTGACTCTCCAGGTCAATTTTGCCGTGTCAAAATACCAATTTGACAGAAACTT
GTGGAGGCGAGTGCGCCACGAAGGAGAAGAAGCCATTGAGATGGGGCGGTCTATTCTCAAGGATATGTCCTTTGA
CTTTTATGTGACAAGCCCAGTCCTTGAGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail