Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|952
Gene name
LocationContig_1255:367..1039
Strand+
Gene length (bp)672
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00551 Formyl_trans_N Formyl transferase 1.3E-35 6 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54I60|PUR3_DICDI Phosphoribosylglycinamide formyltransferase OS=Dictyostelium discoideum GN=purN PE=3 SV=1 6 208 1.0E-45
sp|Q9UUK7|PUR3_SCHPO Phosphoribosylglycinamide formyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade5 PE=2 SV=1 5 217 5.0E-45
sp|P04161|PUR3_YEAST Phosphoribosylglycinamide formyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE8 PE=1 SV=1 6 216 2.0E-32
sp|P43846|PUR3_HAEIN Phosphoribosylglycinamide formyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purN PE=3 SV=1 6 204 3.0E-20
sp|Q5HH12|PUR3_STAAC Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain COL) GN=purN PE=3 SV=1 5 213 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54I60|PUR3_DICDI Phosphoribosylglycinamide formyltransferase OS=Dictyostelium discoideum GN=purN PE=3 SV=1 6 208 1.0E-45
sp|Q9UUK7|PUR3_SCHPO Phosphoribosylglycinamide formyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade5 PE=2 SV=1 5 217 5.0E-45
sp|P04161|PUR3_YEAST Phosphoribosylglycinamide formyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE8 PE=1 SV=1 6 216 2.0E-32
sp|P43846|PUR3_HAEIN Phosphoribosylglycinamide formyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=purN PE=3 SV=1 6 204 3.0E-20
sp|Q5HH12|PUR3_STAAC Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain COL) GN=purN PE=3 SV=1 5 213 1.0E-19
sp|Q6GI12|PUR3_STAAR Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=purN PE=3 SV=1 5 213 2.0E-19
sp|Q8NX89|PUR3_STAAW Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain MW2) GN=purN PE=3 SV=1 6 213 2.0E-19
sp|Q6GAE1|PUR3_STAAS Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=purN PE=3 SV=1 6 213 2.0E-19
sp|P00967|PUR2_DROME Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila melanogaster GN=ade3 PE=1 SV=2 6 219 7.0E-19
sp|P99162|PUR3_STAAN Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain N315) GN=purN PE=1 SV=1 6 213 1.0E-18
sp|P65897|PUR3_STAAM Phosphoribosylglycinamide formyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purN PE=3 SV=1 6 213 1.0E-18
sp|P12040|PUR3_BACSU Phosphoribosylglycinamide formyltransferase OS=Bacillus subtilis (strain 168) GN=purN PE=3 SV=2 9 214 6.0E-18
sp|P16340|PUR2_DROPS Trifunctional purine biosynthetic protein adenosine-3 OS=Drosophila pseudoobscura pseudoobscura GN=ade3 PE=3 SV=2 6 202 9.0E-18
sp|P08179|PUR3_ECOLI Phosphoribosylglycinamide formyltransferase OS=Escherichia coli (strain K12) GN=purN PE=1 SV=1 6 204 2.0E-17
sp|Q59A32|PUR2_BOVIN Trifunctional purine biosynthetic protein adenosine-3 OS=Bos taurus GN=GART PE=2 SV=1 4 208 3.0E-16
sp|Q64737|PUR2_MOUSE Trifunctional purine biosynthetic protein adenosine-3 OS=Mus musculus GN=Gart PE=1 SV=3 4 208 4.0E-16
sp|P22102|PUR2_HUMAN Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens GN=GART PE=1 SV=1 4 205 8.0E-16
sp|Q26255|PUR2_CHITE Trifunctional purine biosynthetic protein adenosine-3 OS=Chironomus tentans GN=GART PE=3 SV=1 4 202 2.0E-15
sp|Q8CT28|PUR3_STAES Phosphoribosylglycinamide formyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purN PE=3 SV=1 5 213 7.0E-15
sp|Q5HQ98|PUR3_STAEQ Phosphoribosylglycinamide formyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purN PE=3 SV=1 5 213 7.0E-15
sp|P21872|PUR2_CHICK Trifunctional purine biosynthetic protein adenosine-3 OS=Gallus gallus GN=GART PE=2 SV=1 4 203 5.0E-13
sp|P9WHM5|PUR3_MYCTU Phosphoribosylglycinamide formyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=purN PE=1 SV=1 2 203 4.0E-11
sp|P9WHM4|PUR3_MYCTO Phosphoribosylglycinamide formyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=purN PE=3 SV=1 2 203 4.0E-11
sp|B9KBC2|FMT_THENN Methionyl-tRNA formyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=fmt PE=3 SV=1 101 216 1.0E-09
sp|A5IJP6|FMT_THEP1 Methionyl-tRNA formyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=fmt PE=3 SV=1 101 223 3.0E-09
sp|B1L8W7|FMT_THESQ Methionyl-tRNA formyltransferase OS=Thermotoga sp. (strain RQ2) GN=fmt PE=3 SV=1 101 223 4.0E-09
sp|Q9WYZ8|FMT_THEMA Methionyl-tRNA formyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fmt PE=3 SV=1 100 212 2.0E-08
sp|B2V969|FMT_SULSY Methionyl-tRNA formyltransferase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=fmt PE=3 SV=1 127 222 1.0E-07
sp|Q65JS5|FMT_BACLD Methionyl-tRNA formyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=fmt PE=3 SV=1 81 223 4.0E-07
sp|P94463|FMT_BACSU Methionyl-tRNA formyltransferase OS=Bacillus subtilis (strain 168) GN=fmt PE=3 SV=2 92 223 7.0E-07
sp|Q8F3K6|FMT_LEPIN Methionyl-tRNA formyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=fmt PE=3 SV=2 129 193 2.0E-06
sp|Q72S34|FMT_LEPIC Methionyl-tRNA formyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=fmt PE=3 SV=1 129 193 2.0E-06
sp|Q8RDM3|FMT_FUSNN Methionyl-tRNA formyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fmt PE=3 SV=2 78 223 4.0E-06
sp|A7Z4J3|FMT_BACMF Methionyl-tRNA formyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=fmt PE=3 SV=1 92 223 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016742 hydroxymethyl-, formyl- and related transferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|952
MAAKCQILVMASGNGSNFQALCDGVADSLIPMASICRLIVNRAKAFATTRADRLGVPWEYFNLIANGFQRKGEHD
ETRLQQARDAYDAALAQKILALEPRPKLIVLAGWMYIFGCRFLDPMSKAGIRVINLHPALPGQYQGANAIERAFA
DFKAGKITKTGIMVHYVIREVDQGAVIMTREVEILPDDDLGRLEARMHSYEHKLIVEATAKVVGEIKEETKEE*
Coding >OphauG2|952
ATGGCGGCAAAATGCCAAATCCTCGTCATGGCGAGCGGCAATGGGTCTAATTTCCAAGCCCTGTGTGACGGCGTG
GCCGACAGTCTCATTCCCATGGCCTCCATCTGCCGTCTTATTGTGAACCGGGCCAAAGCCTTTGCGACGACGAGA
GCAGATCGCTTAGGAGTTCCATGGGAATATTTCAATCTTATTGCCAACGGCTTCCAGCGGAAAGGTGAACATGAT
GAGACGCGGCTGCAGCAGGCGCGTGATGCCTACGATGCGGCTTTAGCGCAAAAGATACTAGCGCTAGAACCCAGA
CCAAAGCTGATCGTCTTGGCTGGCTGGATGTATATCTTTGGGTGCAGATTTCTAGACCCTATGAGTAAGGCGGGA
ATCAGGGTCATAAACCTGCACCCCGCACTACCCGGCCAGTATCAAGGCGCAAACGCTATTGAACGCGCTTTTGCC
GACTTCAAAGCCGGCAAGATAACCAAGACAGGAATCATGGTACACTATGTTATCCGCGAGGTTGACCAGGGCGCC
GTTATCATGACCCGAGAGGTAGAGATATTGCCAGATGATGACCTAGGGCGACTAGAGGCAAGGATGCACTCGTAT
GAGCACAAGTTAATCGTCGAAGCCACTGCCAAGGTAGTTGGCGAGATAAAAGAAGAGACCAAGGAAGAGTAA
Transcript >OphauG2|952
ATGGCGGCAAAATGCCAAATCCTCGTCATGGCGAGCGGCAATGGGTCTAATTTCCAAGCCCTGTGTGACGGCGTG
GCCGACAGTCTCATTCCCATGGCCTCCATCTGCCGTCTTATTGTGAACCGGGCCAAAGCCTTTGCGACGACGAGA
GCAGATCGCTTAGGAGTTCCATGGGAATATTTCAATCTTATTGCCAACGGCTTCCAGCGGAAAGGTGAACATGAT
GAGACGCGGCTGCAGCAGGCGCGTGATGCCTACGATGCGGCTTTAGCGCAAAAGATACTAGCGCTAGAACCCAGA
CCAAAGCTGATCGTCTTGGCTGGCTGGATGTATATCTTTGGGTGCAGATTTCTAGACCCTATGAGTAAGGCGGGA
ATCAGGGTCATAAACCTGCACCCCGCACTACCCGGCCAGTATCAAGGCGCAAACGCTATTGAACGCGCTTTTGCC
GACTTCAAAGCCGGCAAGATAACCAAGACAGGAATCATGGTACACTATGTTATCCGCGAGGTTGACCAGGGCGCC
GTTATCATGACCCGAGAGGTAGAGATATTGCCAGATGATGACCTAGGGCGACTAGAGGCAAGGATGCACTCGTAT
GAGCACAAGTTAATCGTCGAAGCCACTGCCAAGGTAGTTGGCGAGATAAAAGAAGAGACCAAGGAAGAGTAA
Gene >OphauG2|952
ATGGCGGCAAAATGCCAAATCCTCGTCATGGCGAGCGGCAATGGGTCTAATTTCCAAGCCCTGTGTGACGGCGTG
GCCGACAGTCTCATTCCCATGGCCTCCATCTGCCGTCTTATTGTGAACCGGGCCAAAGCCTTTGCGACGACGAGA
GCAGATCGCTTAGGAGTTCCATGGGAATATTTCAATCTTATTGCCAACGGCTTCCAGCGGAAAGGTGAACATGAT
GAGACGCGGCTGCAGCAGGCGCGTGATGCCTACGATGCGGCTTTAGCGCAAAAGATACTAGCGCTAGAACCCAGA
CCAAAGCTGATCGTCTTGGCTGGCTGGATGTATATCTTTGGGTGCAGATTTCTAGACCCTATGAGTAAGGCGGGA
ATCAGGGTCATAAACCTGCACCCCGCACTACCCGGCCAGTATCAAGGCGCAAACGCTATTGAACGCGCTTTTGCC
GACTTCAAAGCCGGCAAGATAACCAAGACAGGAATCATGGTACACTATGTTATCCGCGAGGTTGACCAGGGCGCC
GTTATCATGACCCGAGAGGTAGAGATATTGCCAGATGATGACCTAGGGCGACTAGAGGCAAGGATGCACTCGTAT
GAGCACAAGTTAATCGTCGAAGCCACTGCCAAGGTAGTTGGCGAGATAAAAGAAGAGACCAAGGAAGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail