Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|950
Gene name
LocationContig_1253:59..1778
Strand-
Gene length (bp)1719
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00135 COesterase Carboxylesterase family 1.3E-77 51 549
PF20434 BD-FAE BD-FAE 2.2E-08 140 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 10 572 0.0E+00
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 36 538 1.0E-117
sp|P32948|LIP4_CANRU Lipase 4 OS=Candida rugosa GN=LIP4 PE=3 SV=1 41 556 3.0E-117
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 41 531 4.0E-116
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 41 538 1.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1N9|LIP3_ARTBC Probable secreted lipase ARB_02369 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02369 PE=1 SV=1 10 572 0.0E+00
sp|P32947|LIP3_CANRU Lipase 3 OS=Candida rugosa GN=LIP3 PE=1 SV=1 36 538 1.0E-117
sp|P32948|LIP4_CANRU Lipase 4 OS=Candida rugosa GN=LIP4 PE=3 SV=1 41 556 3.0E-117
sp|P32949|LIP5_CANRU Lipase 5 OS=Candida rugosa GN=LIP5 PE=3 SV=1 41 531 4.0E-116
sp|P20261|LIP1_CANRU Lipase 1 OS=Candida rugosa GN=LIP1 PE=1 SV=3 41 538 1.0E-114
sp|P17573|LIP1_GEOCN Lipase 1 OS=Geotrichum candidum GN=LIP1 PE=1 SV=2 39 570 4.0E-114
sp|P32946|LIP2_CANRU Lipase 2 OS=Candida rugosa GN=LIP2 PE=1 SV=1 43 566 5.0E-114
sp|P22394|LIP2_GEOCN Lipase 2 OS=Geotrichum candidum GN=LIP2 PE=1 SV=2 5 569 8.0E-114
sp|P79066|LIP1_GEOFE Lipase 1 OS=Geotrichum fermentans GN=LIP1 PE=1 SV=1 39 569 2.0E-112
sp|D4ASH1|LIP1_ARTBC Secreted lipase ARB07186/07185 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07185 PE=1 SV=2 44 415 4.0E-45
sp|P37967|PNBA_BACSU Para-nitrobenzyl esterase OS=Bacillus subtilis (strain 168) GN=pnbA PE=1 SV=2 45 423 1.0E-42
sp|Q8BK48|EST2E_MOUSE Pyrethroid hydrolase Ces2e OS=Mus musculus GN=Ces2e PE=1 SV=1 52 374 3.0E-41
sp|Q8I034|EST5A_FELCA Carboxylesterase 5A OS=Felis catus GN=CES5A PE=1 SV=1 11 412 8.0E-41
sp|P23795|ACES_BOVIN Acetylcholinesterase OS=Bos taurus GN=ACHE PE=1 SV=2 53 521 2.0E-40
sp|P21927|CHLE_RABIT Cholinesterase OS=Oryctolagus cuniculus GN=BCHE PE=2 SV=1 53 386 1.0E-39
sp|O62763|ACES_FELCA Acetylcholinesterase OS=Felis catus GN=ACHE PE=3 SV=1 53 521 2.0E-39
sp|Q8QZR3|EST2A_MOUSE Pyrethroid hydrolase Ces2a OS=Mus musculus GN=Ces2a PE=1 SV=1 46 374 3.0E-39
sp|P37136|ACES_RAT Acetylcholinesterase OS=Rattus norvegicus GN=Ache PE=2 SV=1 53 398 1.0E-38
sp|Q64419|EST1_MESAU Liver carboxylesterase OS=Mesocricetus auratus PE=2 SV=1 46 374 2.0E-38
sp|Q9NDG8|ACE4_CAEBR Acetylcholinesterase 4 OS=Caenorhabditis briggsae GN=ace-4 PE=2 SV=1 51 550 3.0E-38
sp|Q91WG0|EST2C_MOUSE Acylcarnitine hydrolase OS=Mus musculus GN=Ces2c PE=1 SV=1 46 374 3.0E-38
sp|P81908|CHLE_HORSE Cholinesterase OS=Equus caballus GN=BCHE PE=1 SV=1 53 404 3.0E-38
sp|P21836|ACES_MOUSE Acetylcholinesterase OS=Mus musculus GN=Ache PE=1 SV=1 53 398 4.0E-38
sp|Q04791|SASB_ANAPL Fatty acyl-CoA hydrolase precursor, medium chain OS=Anas platyrhynchos PE=1 SV=1 46 533 6.0E-38
sp|P32749|CHLE_BOVIN Cholinesterase OS=Bos taurus GN=BCHE PE=2 SV=2 53 376 1.0E-37
sp|Q29499|ACES_RABIT Acetylcholinesterase (Fragment) OS=Oryctolagus cuniculus GN=ACHE PE=2 SV=1 53 521 2.0E-37
sp|O62760|CHLE_FELCA Cholinesterase OS=Felis catus GN=BCHE PE=2 SV=1 53 376 3.0E-37
sp|O62761|CHLE_PANTT Cholinesterase OS=Panthera tigris tigris GN=BCHE PE=2 SV=1 53 376 4.0E-37
sp|P22303|ACES_HUMAN Acetylcholinesterase OS=Homo sapiens GN=ACHE PE=1 SV=1 53 398 6.0E-37
sp|P06276|CHLE_HUMAN Cholinesterase OS=Homo sapiens GN=BCHE PE=1 SV=1 53 376 7.0E-37
sp|Q6AW47|EST5A_CANLF Carboxylesterase 5A OS=Canis lupus familiaris GN=CES5A PE=2 SV=1 11 409 2.0E-36
sp|B2D0J5|EST6_APIME Venom carboxylesterase-6 OS=Apis mellifera PE=2 SV=1 54 476 3.0E-36
sp|Q92035|ACES_BUNFA Acetylcholinesterase OS=Bungarus fasciatus GN=ACHE PE=1 SV=2 5 386 5.0E-36
sp|O00748|EST2_HUMAN Cocaine esterase OS=Homo sapiens GN=CES2 PE=1 SV=1 52 374 2.0E-35
sp|Q6NT32|EST5A_HUMAN Carboxylesterase 5A OS=Homo sapiens GN=CES5A PE=2 SV=1 44 382 2.0E-35
sp|P23141|EST1_HUMAN Liver carboxylesterase 1 OS=Homo sapiens GN=CES1 PE=1 SV=2 42 378 5.0E-35
sp|Q5XG92|EST4A_HUMAN Carboxylesterase 4A OS=Homo sapiens GN=CES4A PE=2 SV=2 53 369 6.0E-35
sp|P23953|EST1C_MOUSE Carboxylesterase 1C OS=Mus musculus GN=Ces1c PE=1 SV=4 51 402 8.0E-35
sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 53 375 1.0E-34
sp|Q03311|CHLE_MOUSE Cholinesterase OS=Mus musculus GN=Bche PE=1 SV=2 53 376 2.0E-34
sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 53 375 4.0E-34
sp|Q8R0W5|EST4A_MOUSE Carboxylesterase 4A OS=Mus musculus GN=Ces4a PE=2 SV=2 6 377 4.0E-34
sp|O46421|EST1_MACFA Liver carboxylesterase 1 OS=Macaca fascicularis GN=CES1 PE=2 SV=1 42 374 9.0E-34
sp|P14943|EST2_RABIT Liver carboxylesterase 2 OS=Oryctolagus cuniculus GN=CES2 PE=1 SV=2 52 531 3.0E-33
sp|P04058|ACES_TORCA Acetylcholinesterase OS=Torpedo californica GN=ache PE=1 SV=2 53 377 1.0E-32
sp|Q04457|EST1_CAEEL Gut esterase 1 OS=Caenorhabditis elegans GN=ges-1 PE=1 SV=1 41 472 1.0E-32
sp|Q27459|ACE1_CAEBR Acetylcholinesterase 1 OS=Caenorhabditis briggsae GN=ace-1 PE=3 SV=1 43 521 2.0E-32
sp|P38433|ACE1_CAEEL Acetylcholinesterase 1 OS=Caenorhabditis elegans GN=ace-1 PE=1 SV=1 43 521 4.0E-32
sp|Q64573|EST4_RAT Liver carboxylesterase 4 OS=Rattus norvegicus PE=2 SV=2 51 564 4.0E-32
sp|P07692|ACES_TORMA Acetylcholinesterase OS=Torpedo marmorata GN=ache PE=1 SV=2 53 377 4.0E-32
sp|Q64285|CEL_MOUSE Bile salt-activated lipase OS=Mus musculus GN=Cel PE=1 SV=1 53 530 5.0E-32
sp|O42275|ACES_ELEEL Acetylcholinesterase OS=Electrophorus electricus GN=ache PE=3 SV=1 56 386 6.0E-32
sp|P16303|CES1D_RAT Carboxylesterase 1D OS=Rattus norvegicus GN=Ces1d PE=1 SV=2 51 380 1.0E-31
sp|P0C6R3|EST4A_BOVIN Carboxylesterase 4A OS=Bos taurus GN=CES4A PE=2 SV=1 53 404 2.0E-31
sp|Q5GRG2|EST5A_RAT Carboxylesterase 5A OS=Rattus norvegicus GN=Ces5a PE=1 SV=1 44 372 2.0E-31
sp|P10959|EST1C_RAT Carboxylesterase 1C OS=Rattus norvegicus GN=Ces1c PE=1 SV=3 50 405 3.0E-31
sp|Q8VCT4|CES1D_MOUSE Carboxylesterase 1D OS=Mus musculus GN=Ces1d PE=1 SV=1 50 380 3.0E-31
sp|Q63010|EST5_RAT Liver carboxylesterase B-1 OS=Rattus norvegicus PE=1 SV=1 51 564 3.0E-31
sp|Q8VCU1|EST3B_MOUSE Carboxylesterase 3B OS=Mus musculus GN=Ces3b PE=1 SV=2 21 397 3.0E-31
sp|P12337|EST1_RABIT Liver carboxylesterase 1 OS=Oryctolagus cuniculus PE=1 SV=3 42 378 3.0E-31
sp|Q64176|EST1E_MOUSE Carboxylesterase 1E OS=Mus musculus GN=Ces1e PE=1 SV=1 50 564 8.0E-31
sp|P07882|CEL_RAT Bile salt-activated lipase OS=Rattus norvegicus GN=Cel PE=1 SV=2 53 557 9.0E-31
sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 53 375 1.0E-30
sp|Q6AW46|EST5A_MOUSE Carboxylesterase 5A OS=Mus musculus GN=Ces5a PE=2 SV=1 44 383 1.0E-30
sp|Q04456|EST1_CAEBR Gut esterase 1 OS=Caenorhabditis briggsae GN=ges-1 PE=2 SV=1 10 532 2.0E-30
sp|Q29550|EST1_PIG Liver carboxylesterase OS=Sus scrofa PE=1 SV=1 51 378 3.0E-30
sp|Q6UWW8|EST3_HUMAN Carboxylesterase 3 OS=Homo sapiens GN=CES3 PE=1 SV=1 21 415 4.0E-30
sp|Q5RCL7|EST3_PONAB Carboxylesterase 3 OS=Pongo abelii GN=CES3 PE=2 SV=2 21 412 5.0E-30
sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 42 569 6.0E-30
sp|P36196|ACES_CHICK Acetylcholinesterase OS=Gallus gallus GN=ACHE PE=2 SV=1 56 354 9.0E-30
sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 42 569 1.0E-29
sp|Q99K10|NLGN1_MOUSE Neuroligin-1 OS=Mus musculus GN=Nlgn1 PE=1 SV=2 42 387 1.0E-29
sp|Q63108|EST1E_RAT Carboxylesterase 1E OS=Rattus norvegicus GN=Ces1e PE=2 SV=1 50 374 2.0E-29
sp|Q63880|EST3A_MOUSE Carboxylesterase 3A OS=Mus musculus GN=Ces3a PE=1 SV=2 14 497 2.0E-29
sp|Q869C3|ACES_ANOGA Acetylcholinesterase OS=Anopheles gambiae GN=Ace PE=3 SV=3 44 531 2.0E-29
sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 53 375 2.0E-29
sp|Q3T930|EST5A_SHEEP Carboxylesterase 5A (Fragment) OS=Ovis aries GN=CES5A PE=1 SV=1 126 378 2.0E-29
sp|Q9DDE3|ACES_DANRE Acetylcholinesterase OS=Danio rerio GN=ache PE=3 SV=1 56 386 3.0E-29
sp|Q47M62|EST1_THEFY Carboxylesterase OS=Thermobifida fusca (strain YX) GN=Tfu_2427 PE=3 SV=1 33 374 4.0E-29
sp|P86325|EST1_THEFU Carboxylesterase OS=Thermobifida fusca PE=1 SV=1 33 374 4.0E-29
sp|P21837|CRYS_DICDI Crystal protein OS=Dictyostelium discoideum GN=cryS PE=1 SV=1 56 380 5.0E-29
sp|Q27677|ACES_LEPDE Acetylcholinesterase OS=Leptinotarsa decemlineata PE=2 SV=1 44 450 5.0E-29
sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=ACHE1 PE=2 SV=2 44 375 6.0E-29
sp|P35501|ESTE_MYZPE Esterase E4 OS=Myzus persicae PE=1 SV=1 5 379 2.0E-28
sp|P30122|CEL_BOVIN Bile salt-activated lipase (Fragment) OS=Bos taurus GN=CEL PE=1 SV=2 9 523 2.0E-28
sp|P35502|ESTF_MYZPE Esterase FE4 OS=Myzus persicae PE=1 SV=1 5 379 2.0E-28
sp|P18142|D2_DICDI cAMP-regulated D2 protein OS=Dictyostelium discoideum GN=D2 PE=2 SV=3 31 433 3.0E-28
sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 53 375 4.0E-28
sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 53 375 5.0E-28
sp|Q8NFZ4|NLGN2_HUMAN Neuroligin-2 OS=Homo sapiens GN=NLGN2 PE=1 SV=1 37 388 5.0E-28
sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 37 388 3.0E-27
sp|Q62888|NLGN2_RAT Neuroligin-2 OS=Rattus norvegicus GN=Nlgn2 PE=1 SV=1 37 388 1.0E-26
sp|Q8VCC2|EST1_MOUSE Liver carboxylesterase 1 OS=Mus musculus GN=Ces1 PE=1 SV=1 42 374 2.0E-26
sp|Q5UR02|CHLE_MIMIV Probable cholinesterase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L906 PE=3 SV=1 51 332 2.0E-26
sp|Q92081|ACES_MYXGL Acetylcholinesterase (Fragment) OS=Myxine glutinosa GN=ache PE=3 SV=1 147 390 2.0E-26
sp|Q9UKY3|CES1P_HUMAN Putative inactive carboxylesterase 4 OS=Homo sapiens GN=CES1P1 PE=5 SV=2 51 273 1.0E-25
sp|D4AZ78|LIP2_ARTBC Secreted lipase ARB_01498 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01498 PE=1 SV=1 125 415 1.0E-25
sp|Q01470|PCD_ARTOX Phenmedipham hydrolase OS=Arthrobacter oxydans GN=pcd PE=1 SV=1 52 406 2.0E-25
sp|Q95000|CHLE1_BRALA Cholinesterase 1 (Fragment) OS=Branchiostoma lanceolatum GN=CHE1 PE=3 SV=1 126 377 4.0E-25
sp|W4VSJ0|ACES_TRILK Acetylcholinesterase-1 OS=Trittame loki PE=1 SV=1 45 301 4.0E-25
sp|O94493|YC7C_SCHPO Uncharacterized esterase/lipase C417.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.12 PE=3 SV=2 56 502 8.0E-25
sp|P07140|ACES_DROME Acetylcholinesterase OS=Drosophila melanogaster GN=Ace PE=1 SV=1 49 504 4.0E-24
sp|P25725|EST5C_DROPS Esterase-5C OS=Drosophila pseudoobscura pseudoobscura GN=Est-5C PE=3 SV=1 42 375 4.0E-24
sp|P08171|EST6_DROME Esterase-6 OS=Drosophila melanogaster GN=Est-6 PE=1 SV=2 55 375 6.0E-24
sp|P16854|EST1_CULPI Esterase B1 OS=Culex pipiens GN=B1 PE=3 SV=1 55 378 9.0E-24
sp|P47982|EST6_DROMA Esterase 6 OS=Drosophila mauritiana GN=Est-6 PE=3 SV=1 55 375 1.0E-23
sp|O16171|EST5C_DROPE Esterase-5C OS=Drosophila persimilis GN=Est-5C PE=3 SV=1 42 375 1.0E-23
sp|O16169|EST5C_DROMI Esterase-5C OS=Drosophila miranda GN=Est-5C PE=3 SV=1 42 375 2.0E-23
sp|D2D3B6|FUMD_SPHMC Fumonisin B1 esterase OS=Sphingopyxis macrogoltabida GN=fumD PE=1 SV=1 37 544 4.0E-23
sp|P19835|CEL_HUMAN Bile salt-activated lipase OS=Homo sapiens GN=CEL PE=1 SV=3 53 246 7.0E-23
sp|P18167|ESTP_DROME Esterase P OS=Drosophila melanogaster GN=Est-P PE=2 SV=2 45 375 2.0E-22
sp|O16173|EST5A_DROPE Esterase-5A OS=Drosophila persimilis GN=Est-5A PE=3 SV=1 55 403 2.0E-22
sp|Q08662|EST6_DROSI Esterase 6 OS=Drosophila simulans GN=Est-6 PE=3 SV=1 55 375 4.0E-22
sp|P25727|EST5A_DROPS Esterase-5A OS=Drosophila pseudoobscura pseudoobscura GN=Est-5A PE=3 SV=3 55 403 5.0E-22
sp|O16168|EST5A_DROMI Esterase-5A OS=Drosophila miranda GN=Est-5A PE=3 SV=1 55 403 5.0E-22
sp|P25726|EST5B_DROPS Esterase-5B OS=Drosophila pseudoobscura pseudoobscura GN=Est-5B PE=2 SV=2 55 473 6.0E-22
sp|O16172|EST5B_DROPE Esterase-5B OS=Drosophila persimilis GN=Est-5B PE=3 SV=1 55 473 7.0E-22
sp|P56161|ACES_ANOST Acetylcholinesterase OS=Anopheles stephensi PE=3 SV=1 50 449 8.0E-22
sp|Q95001|CHLE2_BRALA Cholinesterase 2 (Fragment) OS=Branchiostoma lanceolatum GN=CHE2 PE=3 SV=1 147 376 9.0E-22
sp|Q96VC9|LIP3_YARLI Lipase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP3 PE=3 SV=1 44 322 2.0E-21
sp|O16170|EST5B_DROMI Esterase-5B OS=Drosophila miranda GN=Est-5B PE=3 SV=1 55 473 8.0E-21
sp|P32752|CHLE_PIG Cholinesterase (Fragment) OS=Sus scrofa GN=BCHE PE=2 SV=1 126 246 8.0E-21
sp|P32750|CHLE_CANLF Cholinesterase (Fragment) OS=Canis lupus familiaris GN=BCHE PE=2 SV=1 126 246 9.0E-21
sp|P32753|CHLE_SHEEP Cholinesterase (Fragment) OS=Ovis aries GN=BCHE PE=2 SV=1 126 246 1.0E-20
sp|P32751|CHLE_MACMU Cholinesterase (Fragment) OS=Macaca mulatta GN=BCHE PE=2 SV=1 126 246 3.0E-20
sp|Q07085|EST2_CAEEL Esterase CM06B1 OS=Caenorhabditis elegans GN=F13H6.3 PE=3 SV=3 42 379 6.0E-20
sp|P01267|THYG_BOVIN Thyroglobulin OS=Bos taurus GN=TG PE=1 SV=1 46 377 5.0E-18
sp|P01266|THYG_HUMAN Thyroglobulin OS=Homo sapiens GN=TG PE=1 SV=5 46 377 6.0E-18
sp|Q05487|ESTS_DROVI Esterase S OS=Drosophila virilis GN=EstS PE=2 SV=1 55 322 9.0E-18
sp|Q99156|LIP1_YARLI Lipase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIP1 PE=3 SV=2 44 274 4.0E-16
sp|O08710|THYG_MOUSE Thyroglobulin OS=Mus musculus GN=Tg PE=1 SV=3 46 377 1.0E-15
sp|P33438|GLT_DROME Glutactin OS=Drosophila melanogaster GN=Glt PE=1 SV=2 126 407 2.0E-14
sp|P06882|THYG_RAT Thyroglobulin OS=Rattus norvegicus GN=Tg PE=1 SV=4 46 377 1.0E-13
sp|P12992|ESTJ_HELVI Juvenile hormone esterase OS=Heliothis virescens PE=1 SV=2 46 374 2.0E-13
sp|Q9XTG1|NLGN1_CAEEL Neuroligin-1 OS=Caenorhabditis elegans GN=nlg-1 PE=1 SV=1 58 354 3.0E-13
sp|P23654|NRT_DROME Neurotactin OS=Drosophila melanogaster GN=Nrt PE=1 SV=3 45 282 3.0E-13
sp|Q86GC9|ACES_CULTO Acetylcholinesterase (Fragment) OS=Culex torrentium GN=ACE-1 PE=3 SV=1 49 193 9.0E-08
sp|Q867X2|ACES_CULQU Acetylcholinesterase (Fragment) OS=Culex quinquefasciatus GN=ACE-1 PE=3 SV=1 49 193 9.0E-08
sp|Q867X3|ACES_CULPP Acetylcholinesterase (Fragment) OS=Culex pipiens pipiens GN=ACE-1 PE=3 SV=1 49 193 9.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|950
MKFGLLAVPAALGVLAAAAPRPAINSTLEPRGFDVSVRFNDHDTIVGHSVQGIDTFNGIPYADAPVGPLRLRPPQ
RRTRPLGTLQAPDVAPACPQMWMSDKSTSLMGSLVTQVVSLPMFKSVLGQEDCLTLNVQRPHGTKQGDKLPVLFW
IYGGAFEFGSTALSDGASLLATGMDQDQPFVFVAVNYRLGGFGFMPGRQIKAEGSANLGLLDQRMGLEWVADNIA
AFGGDPDRVTIWGLSAGAISVFDQMALRGGNATYKGKPLFHGAIMNSGSSAPVEPVDCPKAQAVFDLVTATAGCA
SPAVGSELDCLRALPYHDFLAAANAVPGFWSFSSLSLSYLPRPDGHVLPDSPDVLAQQGRYHAVPIIIGNQEDEG
TLMAFSQTNVSSSHDMAQYLSQVFFNRATPAQLQPLVDLYEPALIHGSPFRTGIFNELYPGFKRVAAIVGDLAFT
MARRVTLRALHPANPQTPIWSYLASYGHFFPFVGTFHSFDMAQVFYGLLPNHAMYSCRTYYFNFVYNLDPNVGIT
DYQHWPDWREAQHLMWFKTGSENDILKDDFREDASNWMEQNVHMLRM*
Coding >OphauG2|950
ATGAAGTTTGGGCTCCTCGCAGTGCCTGCTGCCCTCGGGGTATTGGCTGCCGCGGCTCCTCGGCCAGCCATAAAC
TCGACGCTGGAGCCTCGCGGCTTCGACGTCTCTGTGCGTTTCAATGACCATGACACCATTGTCGGGCACTCCGTC
CAGGGCATCGACACCTTCAACGGCATCCCTTATGCCGACGCCCCTGTGGGCCCGCTGCGTCTCCGGCCTCCCCAG
CGCCGGACTCGCCCCCTGGGCACTCTCCAGGCCCCTGATGTAGCGCCCGCCTGTCCGCAAATGTGGATGTCGGAC
AAGTCGACGTCCTTGATGGGAAGCCTCGTGACCCAAGTGGTCAGCCTGCCCATGTTCAAGAGCGTCTTGGGCCAG
GAGGACTGCCTGACGCTCAACGTCCAGCGGCCGCACGGCACCAAGCAAGGCGACAAGCTGCCCGTCCTGTTTTGG
ATCTATGGCGGCGCCTTTGAATTTGGCAGCACGGCCCTGTCCGACGGCGCCAGCCTGCTGGCCACGGGCATGGAC
CAGGACCAGCCCTTTGTCTTTGTGGCCGTCAACTACCGCCTGGGCGGCTTCGGCTTCATGCCCGGGCGCCAAATC
AAGGCCGAGGGCAGCGCCAACCTGGGCCTGCTGGACCAGCGCATGGGCCTCGAGTGGGTGGCGGACAACATTGCT
GCCTTTGGCGGCGACCCGGACCGCGTCACCATCTGGGGGCTGTCGGCCGGCGCCATCTCCGTCTTTGACCAGATG
GCGCTGCGCGGCGGCAACGCCACCTACAAGGGCAAGCCGCTCTTCCATGGCGCCATCATGAACTCGGGCAGCTCC
GCCCCCGTCGAGCCCGTCGACTGTCCCAAGGCCCAGGCCGTCTTTGATCTCGTCACCGCCACCGCCGGCTGCGCC
AGCCCTGCCGTCGGCTCCGAGCTCGACTGTCTGCGCGCCCTGCCCTACCACGACTTCCTCGCCGCCGCCAACGCC
GTCCCCGGCTTCTGGTCCTTTTCCTCCCTGTCCCTGTCCTATCTGCCGCGCCCCGACGGCCATGTGCTGCCCGAT
AGCCCTGACGTGCTCGCCCAGCAGGGCCGCTACCACGCCGTTCCCATCATCATTGGCAACCAGGAGGACGAGGGC
ACCCTCATGGCCTTCTCCCAGACCAACGTCTCCTCCTCCCACGACATGGCCCAATACCTCTCCCAAGTCTTCTTC
AACCGCGCAACGCCCGCTCAGCTCCAGCCCCTCGTCGACCTATATGAGCCCGCCTTGATCCACGGCAGTCCCTTT
CGCACCGGCATCTTCAACGAGCTGTATCCCGGCTTCAAGCGCGTCGCCGCCATTGTTGGCGACTTGGCCTTCACC
ATGGCCCGCCGCGTCACCCTCAGGGCCCTTCATCCCGCCAACCCGCAAACCCCCATCTGGTCCTATCTCGCATCC
TACGGCCACTTTTTCCCCTTTGTCGGCACCTTTCACTCCTTTGACATGGCCCAAGTCTTTTATGGCCTGCTTCCA
AACCATGCCATGTACAGCTGCCGCACCTACTACTTTAACTTTGTCTATAACCTCGACCCCAATGTCGGCATCACC
GACTATCAACACTGGCCCGACTGGAGAGAGGCCCAGCATCTCATGTGGTTCAAGACGGGCTCTGAGAACGATATT
CTCAAGGATGATTTCCGCGAGGATGCCTCCAACTGGATGGAGCAGAATGTCCACATGCTGCGCATGTAA
Transcript >OphauG2|950
ATGAAGTTTGGGCTCCTCGCAGTGCCTGCTGCCCTCGGGGTATTGGCTGCCGCGGCTCCTCGGCCAGCCATAAAC
TCGACGCTGGAGCCTCGCGGCTTCGACGTCTCTGTGCGTTTCAATGACCATGACACCATTGTCGGGCACTCCGTC
CAGGGCATCGACACCTTCAACGGCATCCCTTATGCCGACGCCCCTGTGGGCCCGCTGCGTCTCCGGCCTCCCCAG
CGCCGGACTCGCCCCCTGGGCACTCTCCAGGCCCCTGATGTAGCGCCCGCCTGTCCGCAAATGTGGATGTCGGAC
AAGTCGACGTCCTTGATGGGAAGCCTCGTGACCCAAGTGGTCAGCCTGCCCATGTTCAAGAGCGTCTTGGGCCAG
GAGGACTGCCTGACGCTCAACGTCCAGCGGCCGCACGGCACCAAGCAAGGCGACAAGCTGCCCGTCCTGTTTTGG
ATCTATGGCGGCGCCTTTGAATTTGGCAGCACGGCCCTGTCCGACGGCGCCAGCCTGCTGGCCACGGGCATGGAC
CAGGACCAGCCCTTTGTCTTTGTGGCCGTCAACTACCGCCTGGGCGGCTTCGGCTTCATGCCCGGGCGCCAAATC
AAGGCCGAGGGCAGCGCCAACCTGGGCCTGCTGGACCAGCGCATGGGCCTCGAGTGGGTGGCGGACAACATTGCT
GCCTTTGGCGGCGACCCGGACCGCGTCACCATCTGGGGGCTGTCGGCCGGCGCCATCTCCGTCTTTGACCAGATG
GCGCTGCGCGGCGGCAACGCCACCTACAAGGGCAAGCCGCTCTTCCATGGCGCCATCATGAACTCGGGCAGCTCC
GCCCCCGTCGAGCCCGTCGACTGTCCCAAGGCCCAGGCCGTCTTTGATCTCGTCACCGCCACCGCCGGCTGCGCC
AGCCCTGCCGTCGGCTCCGAGCTCGACTGTCTGCGCGCCCTGCCCTACCACGACTTCCTCGCCGCCGCCAACGCC
GTCCCCGGCTTCTGGTCCTTTTCCTCCCTGTCCCTGTCCTATCTGCCGCGCCCCGACGGCCATGTGCTGCCCGAT
AGCCCTGACGTGCTCGCCCAGCAGGGCCGCTACCACGCCGTTCCCATCATCATTGGCAACCAGGAGGACGAGGGC
ACCCTCATGGCCTTCTCCCAGACCAACGTCTCCTCCTCCCACGACATGGCCCAATACCTCTCCCAAGTCTTCTTC
AACCGCGCAACGCCCGCTCAGCTCCAGCCCCTCGTCGACCTATATGAGCCCGCCTTGATCCACGGCAGTCCCTTT
CGCACCGGCATCTTCAACGAGCTGTATCCCGGCTTCAAGCGCGTCGCCGCCATTGTTGGCGACTTGGCCTTCACC
ATGGCCCGCCGCGTCACCCTCAGGGCCCTTCATCCCGCCAACCCGCAAACCCCCATCTGGTCCTATCTCGCATCC
TACGGCCACTTTTTCCCCTTTGTCGGCACCTTTCACTCCTTTGACATGGCCCAAGTCTTTTATGGCCTGCTTCCA
AACCATGCCATGTACAGCTGCCGCACCTACTACTTTAACTTTGTCTATAACCTCGACCCCAATGTCGGCATCACC
GACTATCAACACTGGCCCGACTGGAGAGAGGCCCAGCATCTCATGTGGTTCAAGACGGGCTCTGAGAACGATATT
CTCAAGGATGATTTCCGCGAGGATGCCTCCAACTGGATGGAGCAGAATGTCCACATGCTGCGCATGTAA
Gene >OphauG2|950
ATGAAGTTTGGGCTCCTCGCAGTGCCTGCTGCCCTCGGGGTATTGGCTGCCGCGGCTCCTCGGCCAGCCATAAAC
TCGACGCTGGAGCCTCGCGGCTTCGACGTCTCTGTGCGTTTCAATGACCATGACACCATTGTCGGGCACTCCGTC
CAGGGCATCGACACCTTCAACGGCATCCCTTATGCCGACGCCCCTGTGGGCCCGCTGCGTCTCCGGCCTCCCCAG
CGCCGGACTCGCCCCCTGGGCACTCTCCAGGCCCCTGATGTAGCGCCCGCCTGTCCGCAAATGTGGATGTCGGAC
AAGTCGACGTCCTTGATGGGAAGCCTCGTGACCCAAGTGGTCAGCCTGCCCATGTTCAAGAGCGTCTTGGGCCAG
GAGGACTGCCTGACGCTCAACGTCCAGCGGCCGCACGGCACCAAGCAAGGCGACAAGCTGCCCGTCCTGTTTTGG
ATCTATGGCGGCGCCTTTGAATTTGGCAGCACGGCCCTGTCCGACGGCGCCAGCCTGCTGGCCACGGGCATGGAC
CAGGACCAGCCCTTTGTCTTTGTGGCCGTCAACTACCGCCTGGGCGGCTTCGGCTTCATGCCCGGGCGCCAAATC
AAGGCCGAGGGCAGCGCCAACCTGGGCCTGCTGGACCAGCGCATGGGCCTCGAGTGGGTGGCGGACAACATTGCT
GCCTTTGGCGGCGACCCGGACCGCGTCACCATCTGGGGGCTGTCGGCCGGCGCCATCTCCGTCTTTGACCAGATG
GCGCTGCGCGGCGGCAACGCCACCTACAAGGGCAAGCCGCTCTTCCATGGCGCCATCATGAACTCGGGCAGCTCC
GCCCCCGTCGAGCCCGTCGACTGTCCCAAGGCCCAGGCCGTCTTTGATCTCGTCACCGCCACCGCCGGCTGCGCC
AGCCCTGCCGTCGGCTCCGAGCTCGACTGTCTGCGCGCCCTGCCCTACCACGACTTCCTCGCCGCCGCCAACGCC
GTCCCCGGCTTCTGGTCCTTTTCCTCCCTGTCCCTGTCCTATCTGCCGCGCCCCGACGGCCATGTGCTGCCCGAT
AGCCCTGACGTGCTCGCCCAGCAGGGCCGCTACCACGCCGTTCCCATCATCATTGGCAACCAGGAGGACGAGGGC
ACCCTCATGGCCTTCTCCCAGACCAACGTCTCCTCCTCCCACGACATGGCCCAATACCTCTCCCAAGTCTTCTTC
AACCGCGCAACGCCCGCTCAGCTCCAGCCCCTCGTCGACCTATATGAGCCCGCCTTGATCCACGGCAGTCCCTTT
CGCACCGGCATCTTCAACGAGCTGTATCCCGGCTTCAAGCGCGTCGCCGCCATTGTTGGCGACTTGGCCTTCACC
ATGGCCCGCCGCGTCACCCTCAGGGCCCTTCATCCCGCCAACCCGCAAACCCCCATCTGGTCCTATCTCGCATCC
TACGGCCACTTTTTCCCCTTTGTCGGCACCTTTCACTCCTTTGACATGGCCCAAGTCTTTTATGGCCTGCTTCCA
AACCATGCCATGTACAGCTGCCGCACCTACTACTTTAACTTTGTCTATAACCTCGACCCCAATGTCGGCATCACC
GACTATCAACACTGGCCCGACTGGAGAGAGGCCCAGCATCTCATGTGGTTCAAGACGGGCTCTGAGAACGATATT
CTCAAGGATGATTTCCGCGAGGATGCCTCCAACTGGATGGAGCAGAATGTCCACATGCTGCGCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail