Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|935
Gene name
LocationContig_125:5899..6826
Strand+
Gene length (bp)927
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04969 CS CS domain 1.6E-06 22 91

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q11118|WOS2_SCHPO Protein wos2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wos2 PE=2 SV=1 6 164 2.0E-38
sp|P28707|SBA1_YEAST Co-chaperone protein SBA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBA1 PE=1 SV=3 3 152 4.0E-24
sp|Q9VH95|YC17_DROME Uncharacterized protein CG16817 OS=Drosophila melanogaster GN=CG16817 PE=1 SV=1 4 144 1.0E-15
sp|Q23280|DAF41_CAEEL Co-chaperone protein daf-41 OS=Caenorhabditis elegans GN=daf-41 PE=2 SV=1 7 119 3.0E-15
sp|Q90955|TEBP_CHICK Prostaglandin E synthase 3 (Fragment) OS=Gallus gallus GN=PTGES3 PE=1 SV=1 25 174 8.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q11118|WOS2_SCHPO Protein wos2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wos2 PE=2 SV=1 6 164 2.0E-38
sp|P28707|SBA1_YEAST Co-chaperone protein SBA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBA1 PE=1 SV=3 3 152 4.0E-24
sp|Q9VH95|YC17_DROME Uncharacterized protein CG16817 OS=Drosophila melanogaster GN=CG16817 PE=1 SV=1 4 144 1.0E-15
sp|Q23280|DAF41_CAEEL Co-chaperone protein daf-41 OS=Caenorhabditis elegans GN=daf-41 PE=2 SV=1 7 119 3.0E-15
sp|Q90955|TEBP_CHICK Prostaglandin E synthase 3 (Fragment) OS=Gallus gallus GN=PTGES3 PE=1 SV=1 25 174 8.0E-14
sp|Q5NVM4|TEBP_PONAB Prostaglandin E synthase 3 OS=Pongo abelii GN=PTGES3 PE=2 SV=1 22 174 5.0E-13
sp|Q6PWL5|TEBP_MACFA Prostaglandin E synthase 3 OS=Macaca fascicularis GN=PTGES3 PE=1 SV=1 22 174 5.0E-13
sp|Q15185|TEBP_HUMAN Prostaglandin E synthase 3 OS=Homo sapiens GN=PTGES3 PE=1 SV=1 22 174 5.0E-13
sp|Q3ZBF7|TEBP_BOVIN Prostaglandin E synthase 3 OS=Bos taurus GN=PTGES3 PE=1 SV=1 22 174 5.0E-13
sp|Q6ID70|Y3377_ARATH Uncharacterized protein At3g03773 OS=Arabidopsis thaliana GN=At3g03773 PE=1 SV=1 7 136 5.0E-13
sp|P0C8Z0|Y8359_ORYSI Uncharacterized protein OsI_027940 OS=Oryza sativa subsp. indica GN=OsI_027940 PE=1 SV=2 7 153 6.0E-13
sp|Q6YYB0|Y8359_ORYSJ Uncharacterized protein Os08g0359500 OS=Oryza sativa subsp. japonica GN=Os08g0359500 PE=2 SV=1 7 153 6.0E-13
sp|P83868|TEBP_RAT Prostaglandin E synthase 3 OS=Rattus norvegicus GN=Ptges3 PE=1 SV=2 22 174 7.0E-13
sp|Q9R0Q7|TEBP_MOUSE Prostaglandin E synthase 3 OS=Mus musculus GN=Ptges3 PE=1 SV=1 22 174 7.0E-13
sp|Q7SY06|HACD3_DANRE Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Danio rerio GN=hacd3 PE=2 SV=2 5 132 2.0E-07
sp|A7YY55|HACD3_BOVIN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Bos taurus GN=HACD3 PE=2 SV=1 3 124 5.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2816
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|935 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6129
Ophiocordyceps camponoti-floridani Ophcf2|05813
Ophiocordyceps camponoti-rufipedis Ophun1|6220
Ophiocordyceps kimflemingae Ophio5|6331
Ophiocordyceps subramaniannii Hirsu2|4542

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|935
MVEMVTPEVLWAQRSSVADASKNFIYLTISVPDIPKEGLQLDIKPASLTFTGTSGTLKRKYHVELEFYAEIDPAE
SKINHTSKNIEMKLQKKELKEEYWPRLLKDSKKLHFLKTDFEKWVDEDEQNEAAEEDFSQFGDMGGMPGMGGLDF
SKLAGGAGGMPDMSAMGLDNMPDLSNMDGSAEDDNENNQDMPELEEANDKATGKD*
Coding >OphauG2|935
ATGGTTGAAATGGTCACTCCTGAAGTTCTTTGGGCTCAGCGCTCATCAGTCGCCGATGCCTCCAAAAATTTTATT
TATCTGACAATCTCTGTCCCTGATATTCCCAAAGAGGGTCTCCAACTTGACATCAAGCCCGCCAGTCTTACCTTC
ACAGGCACGTCCGGGACTCTTAAGCGCAAGTATCACGTCGAGCTTGAGTTTTACGCCGAGATCGACCCCGCGGAG
AGCAAGATCAATCACACGTCCAAGAACATCGAAATGAAGCTACAGAAAAAGGAGCTCAAAGAGGAATACTGGCCA
AGGCTACTAAAAGATAGCAAGAAGCTCCACTTCCTCAAGACCGACTTTGAAAAGTGGGTTGATGAAGATGAGCAG
AACGAAGCTGCCGAGGAGGACTTCTCGCAGTTTGGGGACATGGGCGGAATGCCTGGAATGGGCGGTCTTGACTTC
TCGAAACTTGCTGGCGGTGCTGGCGGCATGCCCGACATGAGTGCTATGGGCCTCGATAACATGCCCGATCTCAGC
AACATGGACGGCTCAGCAGAAGACGATAACGAAAACAACCAAGACATGCCCGAGCTCGAGGAGGCAAATGACAAG
GCAACTGGCAAGGATTAA
Transcript >OphauG2|935
ATGGTTGAAATGGTCACTCCTGAAGTTCTTTGGGCTCAGCGCTCATCAGTCGCCGATGCCTCCAAAAATTTTATT
TATCTGACAATCTCTGTCCCTGATATTCCCAAAGAGGGTCTCCAACTTGACATCAAGCCCGCCAGTCTTACCTTC
ACAGGCACGTCCGGGACTCTTAAGCGCAAGTATCACGTCGAGCTTGAGTTTTACGCCGAGATCGACCCCGCGGAG
AGCAAGATCAATCACACGTCCAAGAACATCGAAATGAAGCTACAGAAAAAGGAGCTCAAAGAGGAATACTGGCCA
AGGCTACTAAAAGATAGCAAGAAGCTCCACTTCCTCAAGACCGACTTTGAAAAGTGGGTTGATGAAGATGAGCAG
AACGAAGCTGCCGAGGAGGACTTCTCGCAGTTTGGGGACATGGGCGGAATGCCTGGAATGGGCGGTCTTGACTTC
TCGAAACTTGCTGGCGGTGCTGGCGGCATGCCCGACATGAGTGCTATGGGCCTCGATAACATGCCCGATCTCAGC
AACATGGACGGCTCAGCAGAAGACGATAACGAAAACAACCAAGACATGCCCGAGCTCGAGGAGGCAAATGACAAG
GCAACTGGCAAGGATTAA
Gene >OphauG2|935
ATGGTTGAAATGGTCACTCCTGAAGGTTTGTTGCTTTTTGTTTTTTTTTTTTGCGTCGTGGCTACGATTGATACT
CAGTATCGCACCCAGACATGGCCCCAACCTGATGCAGGAATTCTCCAGACTACTTTTCACTATCAATTTAAAGAT
GCTGACAGCTTTGTTTGTAGTTCTTTGGGCTCAGCGCTCATCAGTCGCCGATGCCTCCAAAAATTTTATTTATCT
GACAATCTCTGTCCCTGATATTCCCAAAGAGGGTCTCCAACTTGACATCAAGCCCGCCAGTCTTACCTTCACAGG
CACGTCCGGGACTCTTAAGCGCAAGTATCACGTCGAGCTTGAGTTTTACGCCGAGATCGACCCCGCGGAGAGCAA
GATCAATCACACGTCCAAGAACATCGAAATGAAGCTACAGAAAAAGGAGCTCAAAGAGGAATACTGGCCAAGGCT
ACTAAAAGATAGCAAGAAGCTCCACTTCCTCAAGACCGACTTTGAAAAGTGGGTTGATGAAGATGAGCAGAACGA
AGCTGCCGAGGAGGACTTCTCGCAGTTTGGGGACATGGGTGCGTGAATCCGCAAAAGTCTTTTGTCTGCTAAGGA
ACAACATCAAGGCGCTGACTCGAAGCATTAGGCGGAATGCCTGGAATGGGCGGTGCGTCCCATTGATCTATCCTT
CATGCGACCAGCTCCAGACCAACCAGACATAAACATACTCTTGTTATGCTGCAAATACTGACAATTAGCACAGGT
CTTGACTTCTCGAAACTTGCTGGCGGTGCTGGCGGCATGCCCGACATGAGTGCTATGGGCCTCGATAACATGCCC
GATCTCAGCAACATGGACGGCTCAGCAGAAGACGATAACGAAAACAACCAAGACATGCCCGAGCTCGAGGAGGCA
AATGACAAGGCAACTGGCAAGGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail