Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|918
Gene name
LocationContig_1240:3749..5066
Strand+
Gene length (bp)1317
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13428 TPR_14 Tetratricopeptide repeat 1.2E-05 120 159
PF02184 HAT HAT (Half-A-TPR) repeat 1.5E-05 132 157
PF02184 HAT HAT (Half-A-TPR) repeat 3.8E-11 233 263
PF14559 TPR_19 Tetratricopeptide repeat 4.4E-08 128 178

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 46 382 1.0E-180
sp|Q5BDX1|CLF1_EMENI Pre-mRNA-splicing factor clf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clf1 PE=3 SV=2 46 382 5.0E-179
sp|Q5K654|CLF1_PARBR Pre-mRNA-splicing factor CLF1 OS=Paracoccidioides brasiliensis GN=CLF1 PE=3 SV=1 46 379 1.0E-178
sp|Q7SGD2|CLF1_NEUCR Pre-mRNA-splicing factor clf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=clf-1 PE=3 SV=1 46 378 4.0E-177
sp|Q527H0|CLF1_MAGO7 Pre-mRNA-splicing factor CLF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLF1 PE=3 SV=1 46 378 4.0E-171
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 46 382 1.0E-180
sp|Q5BDX1|CLF1_EMENI Pre-mRNA-splicing factor clf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clf1 PE=3 SV=2 46 382 5.0E-179
sp|Q5K654|CLF1_PARBR Pre-mRNA-splicing factor CLF1 OS=Paracoccidioides brasiliensis GN=CLF1 PE=3 SV=1 46 379 1.0E-178
sp|Q7SGD2|CLF1_NEUCR Pre-mRNA-splicing factor clf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=clf-1 PE=3 SV=1 46 378 4.0E-177
sp|Q527H0|CLF1_MAGO7 Pre-mRNA-splicing factor CLF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLF1 PE=3 SV=1 46 378 4.0E-171
sp|P87312|CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf4 PE=1 SV=1 53 384 4.0E-140
sp|Q9HF03|CLF1_CRYNH Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CLF1 PE=3 SV=1 53 379 6.0E-126
sp|P0CO11|CLF1_CRYNB Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CLF1 PE=3 SV=1 53 379 7.0E-126
sp|P0CO10|CLF1_CRYNJ Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CLF1 PE=3 SV=1 53 379 7.0E-126
sp|Q4PB37|CLF1_USTMA Pre-mRNA-splicing factor CLF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLF1 PE=3 SV=1 49 388 1.0E-124
sp|Q6C186|CLF1_YARLI Pre-mRNA-splicing factor CLF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CLF1 PE=3 SV=1 54 377 1.0E-121
sp|P63154|CRNL1_MOUSE Crooked neck-like protein 1 OS=Mus musculus GN=Crnkl1 PE=1 SV=1 54 384 4.0E-118
sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 54 384 4.0E-118
sp|Q9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens GN=CRNKL1 PE=1 SV=4 54 378 7.0E-116
sp|P17886|CRN_DROME Protein crooked neck OS=Drosophila melanogaster GN=crn PE=2 SV=2 54 378 2.0E-111
sp|Q54XP4|CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum GN=crnkl1 PE=3 SV=1 51 377 1.0E-99
sp|Q12309|CLF1_YEAST Pre-mRNA-splicing factor CLF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLF1 PE=1 SV=1 59 394 5.0E-81
sp|Q6BSP7|CLF1_DEBHA Pre-mRNA-splicing factor CLF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CLF1 PE=3 SV=2 64 377 9.0E-80
sp|Q6CJK2|CLF1_KLULA Pre-mRNA-splicing factor CLF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CLF1 PE=3 SV=1 65 386 7.0E-78
sp|Q5AED6|CLF1_CANAL Pre-mRNA-splicing factor CLF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLF1 PE=3 SV=2 64 383 1.0E-77
sp|Q750X3|CLF1_ASHGO Pre-mRNA-splicing factor CLF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLF1 PE=3 SV=1 91 377 5.0E-74
sp|Q6FW76|CLF1_CANGA Pre-mRNA-splicing factor CLF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CLF1 PE=3 SV=1 64 378 2.0E-73
sp|A1A5S1|PRP6_RAT Pre-mRNA-processing factor 6 OS=Rattus norvegicus GN=Prpf6 PE=1 SV=1 118 375 6.0E-16
sp|Q6C186|CLF1_YARLI Pre-mRNA-splicing factor CLF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CLF1 PE=3 SV=1 114 339 1.0E-15
sp|Q91YR7|PRP6_MOUSE Pre-mRNA-processing factor 6 OS=Mus musculus GN=Prpf6 PE=1 SV=1 118 375 1.0E-15
sp|P17886|CRN_DROME Protein crooked neck OS=Drosophila melanogaster GN=crn PE=2 SV=2 114 390 2.0E-15
sp|O94906|PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens GN=PRPF6 PE=1 SV=1 118 375 3.0E-15
sp|Q2KJJ0|PRP6_BOVIN Pre-mRNA-processing factor 6 OS=Bos taurus GN=PRPF6 PE=2 SV=1 118 375 3.0E-15
sp|Q6C186|CLF1_YARLI Pre-mRNA-splicing factor CLF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CLF1 PE=3 SV=1 101 317 3.0E-15
sp|Q7SGD2|CLF1_NEUCR Pre-mRNA-splicing factor clf-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=clf-1 PE=3 SV=1 84 339 4.0E-15
sp|Q54XP4|CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum GN=crnkl1 PE=3 SV=1 100 317 5.0E-15
sp|Q527H0|CLF1_MAGO7 Pre-mRNA-splicing factor CLF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLF1 PE=3 SV=1 100 334 6.0E-15
sp|Q5RCC2|PRP6_PONAB Pre-mRNA-processing factor 6 OS=Pongo abelii GN=PRPF6 PE=2 SV=1 118 375 1.0E-14
sp|Q54XP4|CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum GN=crnkl1 PE=3 SV=1 106 375 2.0E-14
sp|P87312|CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf4 PE=1 SV=1 114 320 3.0E-13
sp|Q9HF03|CLF1_CRYNH Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CLF1 PE=3 SV=1 100 317 6.0E-13
sp|P0CO10|CLF1_CRYNJ Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CLF1 PE=3 SV=1 100 317 6.0E-13
sp|P0CO11|CLF1_CRYNB Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CLF1 PE=3 SV=1 100 317 6.0E-13
sp|Q9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens GN=CRNKL1 PE=1 SV=4 120 392 1.0E-12
sp|P0CO09|SYF1_CRYNB Pre-mRNA-splicing factor SYF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SYF1 PE=3 SV=1 132 341 3.0E-12
sp|P0CO08|SYF1_CRYNJ Pre-mRNA-splicing factor SYF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SYF1 PE=3 SV=1 132 341 3.0E-12
sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 120 292 4.0E-12
sp|P63154|CRNL1_MOUSE Crooked neck-like protein 1 OS=Mus musculus GN=Crnkl1 PE=1 SV=1 120 292 4.0E-12
sp|Q5BDX1|CLF1_EMENI Pre-mRNA-splicing factor clf1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clf1 PE=3 SV=2 100 339 1.0E-11
sp|Q4WT84|CLF1_ASPFU Pre-mRNA-splicing factor clf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clf1 PE=3 SV=1 84 334 3.0E-11
sp|Q9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens GN=CRNKL1 PE=1 SV=4 120 375 4.0E-11
sp|Q12381|PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp1 PE=1 SV=1 119 326 5.0E-11
sp|P63154|CRNL1_MOUSE Crooked neck-like protein 1 OS=Mus musculus GN=Crnkl1 PE=1 SV=1 100 343 1.0E-10
sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 100 343 1.0E-10
sp|Q5K654|CLF1_PARBR Pre-mRNA-splicing factor CLF1 OS=Paracoccidioides brasiliensis GN=CLF1 PE=3 SV=1 84 317 3.0E-10
sp|Q527H0|CLF1_MAGO7 Pre-mRNA-splicing factor CLF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLF1 PE=3 SV=1 120 298 4.0E-10
sp|P63154|CRNL1_MOUSE Crooked neck-like protein 1 OS=Mus musculus GN=Crnkl1 PE=1 SV=1 120 375 1.0E-09
sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 120 375 1.0E-09
sp|Q9HF03|CLF1_CRYNH Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CLF1 PE=3 SV=1 120 322 2.0E-09
sp|Q8RWG2|CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana GN=HCF107 PE=1 SV=1 106 286 2.0E-09
sp|P0CO10|CLF1_CRYNJ Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CLF1 PE=3 SV=1 120 346 2.0E-09
sp|P0CO11|CLF1_CRYNB Pre-mRNA-splicing factor CLF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CLF1 PE=3 SV=1 120 346 2.0E-09
sp|P87312|CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf4 PE=1 SV=1 117 375 3.0E-09
sp|Q9ZT71|STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana GN=STA1 PE=1 SV=1 119 370 5.0E-09
sp|Q750X3|CLF1_ASHGO Pre-mRNA-splicing factor CLF1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLF1 PE=3 SV=1 120 391 6.0E-09
sp|Q4PB37|CLF1_USTMA Pre-mRNA-splicing factor CLF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLF1 PE=3 SV=1 130 315 9.0E-09
sp|Q6CJK2|CLF1_KLULA Pre-mRNA-splicing factor CLF1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CLF1 PE=3 SV=1 71 315 1.0E-08
sp|Q8RWG2|CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana GN=HCF107 PE=1 SV=1 120 320 2.0E-08
sp|Q527H0|CLF1_MAGO7 Pre-mRNA-splicing factor CLF1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLF1 PE=3 SV=1 120 375 4.0E-08
sp|P87312|CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf4 PE=1 SV=1 108 373 4.0E-08
sp|Q4P7S1|SYF1_USTMA Pre-mRNA-splicing factor SYF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SYF1 PE=3 SV=1 72 341 5.0E-08
sp|Q8GUP1|CTF77_ARATH Cleavage stimulation factor subunit 77 OS=Arabidopsis thaliana GN=CSTF77 PE=1 SV=1 140 346 7.0E-08
sp|Q9P7R9|SYF1_SCHPO Pre-mRNA-splicing factor cwf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf3 PE=1 SV=1 120 329 9.0E-08
sp|Q54Z08|SYF1_DICDI Pre-mRNA-splicing factor SYF1 OS=Dictyostelium discoideum GN=xab2 PE=3 SV=1 120 364 4.0E-07
sp|Q14690|RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 67 282 5.0E-07
sp|Q8RWG2|CF107_ARATH Protein high chlorophyll fluorescent 107 OS=Arabidopsis thaliana GN=HCF107 PE=1 SV=1 129 325 6.0E-07
sp|Q6NS46|RRP5_MOUSE Protein RRP5 homolog OS=Mus musculus GN=Pdcd11 PE=1 SV=2 140 320 9.0E-07
sp|Q9ZT71|STA1_ARATH Protein STABILIZED1 OS=Arabidopsis thaliana GN=STA1 PE=1 SV=1 89 280 9.0E-07
sp|Q2KJJ0|PRP6_BOVIN Pre-mRNA-processing factor 6 OS=Bos taurus GN=PRPF6 PE=2 SV=1 127 347 1.0E-06
sp|Q12309|CLF1_YEAST Pre-mRNA-splicing factor CLF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLF1 PE=1 SV=1 120 298 1.0E-06
sp|Q9FNS4|MBB1_CHLRE PsbB mRNA maturation factor Mbb1, chloroplastic OS=Chlamydomonas reinhardtii GN=MBB1 PE=2 SV=1 123 270 2.0E-06
sp|Q6NS46|RRP5_MOUSE Protein RRP5 homolog OS=Mus musculus GN=Pdcd11 PE=1 SV=2 67 282 2.0E-06
sp|Q9HCS7|SYF1_HUMAN Pre-mRNA-splicing factor SYF1 OS=Homo sapiens GN=XAB2 PE=1 SV=2 112 352 2.0E-06
sp|P17886|CRN_DROME Protein crooked neck OS=Drosophila melanogaster GN=crn PE=2 SV=2 140 349 2.0E-06
sp|O94906|PRP6_HUMAN Pre-mRNA-processing factor 6 OS=Homo sapiens GN=PRPF6 PE=1 SV=1 127 347 2.0E-06
sp|Q91YR7|PRP6_MOUSE Pre-mRNA-processing factor 6 OS=Mus musculus GN=Prpf6 PE=1 SV=1 127 347 2.0E-06
sp|A1A5S1|PRP6_RAT Pre-mRNA-processing factor 6 OS=Rattus norvegicus GN=Prpf6 PE=1 SV=1 127 347 2.0E-06
sp|Q4PB37|CLF1_USTMA Pre-mRNA-splicing factor CLF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLF1 PE=3 SV=1 120 341 2.0E-06
sp|Q99PK0|SYF1_RAT Pre-mRNA-splicing factor SYF1 OS=Rattus norvegicus GN=Xab2 PE=2 SV=1 110 216 3.0E-06
sp|Q99PK0|SYF1_RAT Pre-mRNA-splicing factor SYF1 OS=Rattus norvegicus GN=Xab2 PE=2 SV=1 112 352 3.0E-06
sp|Q9DCD2|SYF1_MOUSE Pre-mRNA-splicing factor SYF1 OS=Mus musculus GN=Xab2 PE=1 SV=1 112 352 3.0E-06
sp|Q9DCD2|SYF1_MOUSE Pre-mRNA-splicing factor SYF1 OS=Mus musculus GN=Xab2 PE=1 SV=1 110 216 3.0E-06
sp|Q12381|PRP1_SCHPO Pre-mRNA-splicing factor prp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp1 PE=1 SV=1 121 373 3.0E-06
sp|Q14690|RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 140 320 4.0E-06
sp|Q9HCS7|SYF1_HUMAN Pre-mRNA-splicing factor SYF1 OS=Homo sapiens GN=XAB2 PE=1 SV=2 110 216 4.0E-06
sp|Q6BSP7|CLF1_DEBHA Pre-mRNA-splicing factor CLF1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CLF1 PE=3 SV=2 69 318 5.0E-06
sp|Q4PB37|CLF1_USTMA Pre-mRNA-splicing factor CLF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLF1 PE=3 SV=1 120 346 7.0E-06
sp|Q05022|RRP5_YEAST rRNA biogenesis protein RRP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP5 PE=1 SV=1 140 320 7.0E-06
sp|A7MB10|RRP5_BOVIN Protein RRP5 homolog OS=Bos taurus GN=PDCD11 PE=2 SV=1 72 325 7.0E-06
sp|Q9P7R9|SYF1_SCHPO Pre-mRNA-splicing factor cwf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf3 PE=1 SV=1 133 370 8.0E-06
sp|Q4P7S1|SYF1_USTMA Pre-mRNA-splicing factor SYF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SYF1 PE=3 SV=1 135 274 9.0E-06
sp|Q9LEM8|NAC2_CHLRE PsbD mRNA maturation factor Nac2, chloroplastic OS=Chlamydomonas reinhardtii GN=NAC2 PE=1 SV=1 117 307 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0090304 nucleic acid metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup519
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6230
Ophiocordyceps australis 1348a (Ghana) OphauG2|918 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2593
Ophiocordyceps australis map64 (Brazil) OphauB2|3503
Ophiocordyceps camponoti-floridani Ophcf2|00155
Ophiocordyceps camponoti-rufipedis Ophun1|7160
Ophiocordyceps kimflemingae Ophio5|631
Ophiocordyceps subramaniannii Hirsu2|2379

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|918
MTATYLGRREGGPKIKPDSNVDSNVDANPDSNPDSNLDVKNLNVGMESSRGPPRVKNKAAAPVQISAEQLLREAV
DRQEVSLQTPTQRFSDLEELHEYQGRKRKEFEDYIRRNRVSIHNWTQYAQWELEQNEFARARSVFERALDVHPHN
VQLWMRYIEAELKARNINHARNLLDRAVTLLPRVDKLWYKYVYTEELLGNIAGTRRVFDRWMQWQPDEAAWGAYI
KLEKRYGEYERARDIFASLTLVHPEPRNWIKWARFEEEHGSSERVRNVFGTALQTLDDDMADERLLMAYARFETK
LKQYHRARAIYKHALDRLPRSRSMLLHQAYTRFEKQFGDTDGIEHVVLNKRTKHYEELVRQNPSDYDAWIDYAAL
AESCPQPTTSAIGVATFGSGSRMPSSA*
Coding >OphauG2|918
ATGACTGCAACGTATCTGGGCCGACGTGAAGGCGGGCCCAAAATCAAGCCCGACTCCAACGTCGACTCCAACGTC
GACGCCAACCCCGACTCCAACCCCGACTCCAACCTCGACGTCAAAAACCTCAACGTCGGCATGGAATCATCTCGA
GGCCCCCCCCGCGTCAAAAACAAGGCGGCAGCGCCCGTCCAAATCAGCGCCGAGCAGCTGCTCCGCGAAGCCGTC
GACCGGCAAGAAGTGTCGCTGCAGACGCCAACACAGCGCTTCAGCGACCTCGAGGAGCTGCACGAGTACCAGGGA
CGCAAGCGCAAGGAGTTTGAGGACTACATCCGCCGCAACCGCGTCAGCATCCACAACTGGACGCAGTATGCCCAG
TGGGAGCTGGAGCAAAACGAGTTTGCGCGCGCCCGGTCCGTGTTTGAGCGCGCCCTCGACGTGCACCCGCACAAT
GTCCAGCTCTGGATGCGCTACATTGAAGCCGAGCTCAAGGCACGCAACATCAACCACGCCCGCAACCTGCTGGAC
CGCGCCGTGACACTGCTGCCTCGAGTCGACAAGCTGTGGTACAAGTACGTCTACACGGAGGAGCTGCTGGGCAAT
ATTGCCGGCACCCGCCGCGTCTTTGACCGCTGGATGCAATGGCAGCCCGACGAGGCGGCCTGGGGCGCCTACATC
AAGCTGGAGAAGCGCTACGGCGAGTACGAGCGCGCCCGCGACATCTTTGCCTCGCTGACCCTGGTGCACCCCGAG
CCGCGCAACTGGATCAAGTGGGCCCGCTTCGAGGAGGAGCATGGCTCCAGCGAGCGCGTGCGCAACGTCTTTGGC
ACCGCCCTGCAGACCCTCGACGACGACATGGCTGACGAGCGCCTCCTCATGGCCTATGCCCGCTTCGAGACCAAG
CTCAAGCAATACCACCGCGCCCGCGCCATCTACAAGCATGCCCTGGACCGCCTGCCGCGCTCACGCTCCATGCTG
CTGCACCAGGCCTACACGCGCTTCGAGAAGCAGTTTGGCGACACCGATGGCATCGAGCACGTCGTCCTCAACAAG
CGCACCAAGCATTACGAGGAGCTGGTGCGCCAAAACCCCTCCGACTACGATGCCTGGATCGACTATGCCGCCCTG
GCCGAGTCCTGCCCCCAACCCACGACAAGCGCCATTGGCGTCGCTACCTTTGGCTCTGGATCTCGTATGCCGTCT
TCTGCTTGA
Transcript >OphauG2|918
ATGACTGCAACGTATCTGGGCCGACGTGAAGGCGGGCCCAAAATCAAGCCCGACTCCAACGTCGACTCCAACGTC
GACGCCAACCCCGACTCCAACCCCGACTCCAACCTCGACGTCAAAAACCTCAACGTCGGCATGGAATCATCTCGA
GGCCCCCCCCGCGTCAAAAACAAGGCGGCAGCGCCCGTCCAAATCAGCGCCGAGCAGCTGCTCCGCGAAGCCGTC
GACCGGCAAGAAGTGTCGCTGCAGACGCCAACACAGCGCTTCAGCGACCTCGAGGAGCTGCACGAGTACCAGGGA
CGCAAGCGCAAGGAGTTTGAGGACTACATCCGCCGCAACCGCGTCAGCATCCACAACTGGACGCAGTATGCCCAG
TGGGAGCTGGAGCAAAACGAGTTTGCGCGCGCCCGGTCCGTGTTTGAGCGCGCCCTCGACGTGCACCCGCACAAT
GTCCAGCTCTGGATGCGCTACATTGAAGCCGAGCTCAAGGCACGCAACATCAACCACGCCCGCAACCTGCTGGAC
CGCGCCGTGACACTGCTGCCTCGAGTCGACAAGCTGTGGTACAAGTACGTCTACACGGAGGAGCTGCTGGGCAAT
ATTGCCGGCACCCGCCGCGTCTTTGACCGCTGGATGCAATGGCAGCCCGACGAGGCGGCCTGGGGCGCCTACATC
AAGCTGGAGAAGCGCTACGGCGAGTACGAGCGCGCCCGCGACATCTTTGCCTCGCTGACCCTGGTGCACCCCGAG
CCGCGCAACTGGATCAAGTGGGCCCGCTTCGAGGAGGAGCATGGCTCCAGCGAGCGCGTGCGCAACGTCTTTGGC
ACCGCCCTGCAGACCCTCGACGACGACATGGCTGACGAGCGCCTCCTCATGGCCTATGCCCGCTTCGAGACCAAG
CTCAAGCAATACCACCGCGCCCGCGCCATCTACAAGCATGCCCTGGACCGCCTGCCGCGCTCACGCTCCATGCTG
CTGCACCAGGCCTACACGCGCTTCGAGAAGCAGTTTGGCGACACCGATGGCATCGAGCACGTCGTCCTCAACAAG
CGCACCAAGCATTACGAGGAGCTGGTGCGCCAAAACCCCTCCGACTACGATGCCTGGATCGACTATGCCGCCCTG
GCCGAGTCCTGCCCCCAACCCACGACAAGCGCCATTGGCGTCGCTACCTTTGGCTCTGGATCTCGTATGCCGTCT
TCTGCTTGA
Gene >OphauG2|918
ATGACTGCAGTAGGAGGGAGACGGCGGAGCACACGTGGCTGCCCACGTCTCGGGACCTACCCTAGACGTATCTGG
GCCGACGTGAAGGCGGGCCCAAAATCAAGCCCGACTCCAACGTCGACTCCAACGTCGACGCCAACCCCGACTCCA
ACCCCGACTCCAACCTCGACGTCAAAAACCTCAACGTCGGCATGGAATCATCTCGAGGCCCCCCCCGCGTCAAAA
ACAAGGCGGCAGCGCCCGTCCAAATCAGCGCCGAGCAGCTGCTCCGCGAAGCCGTCGACCGGCAAGAAGTGTCGC
TGCAGACGCCAACACAGCGCTTCAGCGACCTCGAGGAGCTGCACGAGTACCAGGGACGCAAGCGCAAGGAGTTTG
AGGACTACATCCGCCGCAACCGCGTCAGCATCCACAACTGGACGCAGTATGCCCAGTGGGAGCTGGAGCAAAACG
AGTTTGCGCGCGCCCGGTCCGTGTTTGAGCGCGCCCTCGACGTGCACCCGCACAATGTCCAGCTCTGGATGCGCT
ACATTGAAGCCGAGCTCAAGGCACGCAACATCAACCACGCCCGCAACCTGCTGGACCGCGCCGTGACACTGCTGC
CTCGAGTCGACAAGCTGTGGTACAAGTACGTCTACACGGAGGAGCTGCTGGGCAATATTGCCGGCACCCGCCGCG
TCTTTGACCGCTGGATGCAATGGCAGCCCGACGAGGCGGCCTGGGGCGCCTACATCAAGCTGGAGAAGCGCTACG
GCGAGTACGAGCGCGCCCGCGACATCTTTGCCTCGCTGACCCTGGTGCACCCCGAGCCGCGCAACTGGATCAAGT
GGGCCCGCTTCGAGGAGGAGCATGGCTCCAGCGAGCGCGTGCGCAACGTCTTTGGCACCGCCCTGCAGACCCTCG
ACGACGACATGGCTGACGAGCGCCTCCTCATGGCCTATGCCCGCTTCGAGACCAAGCTCAAGCAATACCACCGCG
CCCGCGCCATCTACAAGCATGCCCTGGACCGCCTGCCGCGCTCACGCTCCATGCTGCTGCACCAGGCCTACACGC
GCTTCGAGAAGCAGTTTGGCGACACCGATGGCATCGAGCACGTCGTCCTCAACAAGCGCACCAAGCATTACGAGG
AGCTGGTGCGCCAAAACCCCTCCGACTACGATGCCTGGATCGACTATGCCGCCCTGGCCGAGTCGTCCCACGACG
CCGCCCGCATCCGCGACGTCTATGAGCGCGCCGTGGCCCAGCTGCCCCCAACCCACGACAAGCGCCATTGGCGTC
GCTACCTTTGGCTCTGGATCTCGTATGCCGTCTTCTGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail