Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|903
Gene name
LocationContig_124:20..1193
Strand+
Gene length (bp)1173
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 7.1E-28 159 356

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13926|YF66_SCHPO UPF0665 family protein C23C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C4.06c PE=3 SV=1 1 389 3.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|903
MHYLRLLRRPRHVAPSPGILHVELVVTITTDLGDSFLCPSDAISLRASVEVGSAAYALSPSPQLQWAPGQRVVKP
RLALPPVAVSAWALGQVVRVCIKTANDALSAKSLDSILESATDPNASGLVMPLCVVLQGKGDASGGEYTTRRLRW
RRHADAWTCLDIDEEIGESIARHVWDAGVVAVAALAAGAHGSLQSTTAQHPLMQSVMQVLDGAGPGLNILELGCG
VGILGLGLGAIISRPCTLLMTDVDQAAGACTRSNLVRAEPSAAKLSYEMLDWEVARRGQFGPQVRHRPWHLIMLS
DCTYNADALPALVGTLTALSAANSRQTHGGHGFITRVLVAMKPRHASERAFFHLMAAQGWKALAETLVFQLPEIG
RESGSVEMHLFEKEP*
Coding >OphauG2|903
ATGCACTACCTTCGGCTGCTCCGTCGCCCAAGGCACGTGGCTCCGTCCCCTGGCATCTTGCACGTGGAGCTCGTT
GTCACCATAACAACAGACCTTGGCGACTCGTTTCTGTGTCCGTCCGACGCCATCAGTCTACGTGCCAGCGTCGAG
GTAGGCTCTGCGGCATACGCCCTCTCACCCTCGCCCCAGCTACAATGGGCCCCAGGCCAGCGCGTAGTAAAGCCT
CGGCTTGCCCTGCCACCTGTTGCCGTGAGCGCCTGGGCATTGGGCCAAGTGGTTCGAGTTTGCATCAAGACGGCC
AATGATGCCTTGTCAGCCAAGAGCCTCGACTCCATTCTCGAGTCTGCTACCGACCCCAATGCTTCGGGCTTGGTT
ATGCCCCTTTGCGTAGTGCTGCAAGGCAAGGGCGACGCGAGCGGGGGCGAGTACACCACGCGAAGGCTTCGTTGG
CGACGCCATGCCGACGCCTGGACATGCCTCGACATAGACGAGGAGATTGGTGAGAGCATTGCACGTCACGTATGG
GATGCTGGCGTTGTGGCTGTGGCTGCGCTGGCTGCTGGGGCGCACGGCTCGCTCCAGTCGACAACAGCACAGCAT
CCCCTCATGCAAAGCGTGATGCAGGTGCTCGACGGCGCCGGGCCAGGGCTCAACATCCTCGAACTGGGATGCGGT
GTTGGTATCTTGGGCCTTGGTCTGGGAGCCATTATCAGCCGCCCATGCACATTACTCATGACGGATGTGGACCAA
GCGGCCGGGGCCTGCACACGCTCCAACCTTGTCCGAGCAGAGCCGTCGGCTGCCAAGCTGTCATATGAGATGCTC
GACTGGGAGGTGGCAAGGCGTGGCCAATTTGGACCTCAGGTACGTCACCGGCCCTGGCATCTCATCATGCTCAGC
GACTGTACCTACAACGCAGATGCGTTGCCGGCTCTTGTTGGTACTCTGACGGCTCTCAGTGCCGCAAACTCGAGA
CAGACACATGGCGGCCATGGCTTTATTACCAGAGTCTTGGTGGCAATGAAACCGCGCCATGCTTCTGAGAGGGCT
TTTTTCCATCTCATGGCAGCGCAAGGGTGGAAAGCCCTTGCAGAGACACTGGTCTTTCAGCTGCCAGAGATAGGG
CGCGAGAGCGGTTCAGTGGAGATGCATCTGTTTGAAAAGGAGCCCTAG
Transcript >OphauG2|903
ATGCACTACCTTCGGCTGCTCCGTCGCCCAAGGCACGTGGCTCCGTCCCCTGGCATCTTGCACGTGGAGCTCGTT
GTCACCATAACAACAGACCTTGGCGACTCGTTTCTGTGTCCGTCCGACGCCATCAGTCTACGTGCCAGCGTCGAG
GTAGGCTCTGCGGCATACGCCCTCTCACCCTCGCCCCAGCTACAATGGGCCCCAGGCCAGCGCGTAGTAAAGCCT
CGGCTTGCCCTGCCACCTGTTGCCGTGAGCGCCTGGGCATTGGGCCAAGTGGTTCGAGTTTGCATCAAGACGGCC
AATGATGCCTTGTCAGCCAAGAGCCTCGACTCCATTCTCGAGTCTGCTACCGACCCCAATGCTTCGGGCTTGGTT
ATGCCCCTTTGCGTAGTGCTGCAAGGCAAGGGCGACGCGAGCGGGGGCGAGTACACCACGCGAAGGCTTCGTTGG
CGACGCCATGCCGACGCCTGGACATGCCTCGACATAGACGAGGAGATTGGTGAGAGCATTGCACGTCACGTATGG
GATGCTGGCGTTGTGGCTGTGGCTGCGCTGGCTGCTGGGGCGCACGGCTCGCTCCAGTCGACAACAGCACAGCAT
CCCCTCATGCAAAGCGTGATGCAGGTGCTCGACGGCGCCGGGCCAGGGCTCAACATCCTCGAACTGGGATGCGGT
GTTGGTATCTTGGGCCTTGGTCTGGGAGCCATTATCAGCCGCCCATGCACATTACTCATGACGGATGTGGACCAA
GCGGCCGGGGCCTGCACACGCTCCAACCTTGTCCGAGCAGAGCCGTCGGCTGCCAAGCTGTCATATGAGATGCTC
GACTGGGAGGTGGCAAGGCGTGGCCAATTTGGACCTCAGGTACGTCACCGGCCCTGGCATCTCATCATGCTCAGC
GACTGTACCTACAACGCAGATGCGTTGCCGGCTCTTGTTGGTACTCTGACGGCTCTCAGTGCCGCAAACTCGAGA
CAGACACATGGCGGCCATGGCTTTATTACCAGAGTCTTGGTGGCAATGAAACCGCGCCATGCTTCTGAGAGGGCT
TTTTTCCATCTCATGGCAGCGCAAGGGTGGAAAGCCCTTGCAGAGACACTGGTCTTTCAGCTGCCAGAGATAGGG
CGCGAGAGCGGTTCAGTGGAGATGCATCTGTTTGAAAAGGAGCCCTAG
Gene >OphauG2|903
ATGCACTACCTTCGGCTGCTCCGTCGCCCAAGGCACGTGGCTCCGTCCCCTGGCATCTTGCACGTGGAGCTCGTT
GTCACCATAACAACAGACCTTGGCGACTCGTTTCTGTGTCCGTCCGACGCCATCAGTCTACGTGCCAGCGTCGAG
GTAGGCTCTGCGGCATACGCCCTCTCACCCTCGCCCCAGCTACAATGGGCCCCAGGCCAGCGCGTAGTAAAGCCT
CGGCTTGCCCTGCCACCTGTTGCCGTGAGCGCCTGGGCATTGGGCCAAGTGGTTCGAGTTTGCATCAAGACGGCC
AATGATGCCTTGTCAGCCAAGAGCCTCGACTCCATTCTCGAGTCTGCTACCGACCCCAATGCTTCGGGCTTGGTT
ATGCCCCTTTGCGTAGTGCTGCAAGGCAAGGGCGACGCGAGCGGGGGCGAGTACACCACGCGAAGGCTTCGTTGG
CGACGCCATGCCGACGCCTGGACATGCCTCGACATAGACGAGGAGATTGGTGAGAGCATTGCACGTCACGTATGG
GATGCTGGCGTTGTGGCTGTGGCTGCGCTGGCTGCTGGGGCGCACGGCTCGCTCCAGTCGACAACAGCACAGCAT
CCCCTCATGCAAAGCGTGATGCAGGTGCTCGACGGCGCCGGGCCAGGGCTCAACATCCTCGAACTGGGATGCGGT
GTTGGTATCTTGGGCCTTGGTCTGGGAGCCATTATCAGCCGCCCATGCACATTACTCATGACGGATGTGGACCAA
GCGGCCGGGGCCTGCACACGCTCCAACCTTGTCCGAGCAGAGCCGTCGGCTGCCAAGCTGTCATATGAGATGCTC
GACTGGGAGGTGGCAAGGCGTGGCCAATTTGGACCTCAGGTACGTCACCGGCCCTGGCATCTCATCATGCTCAGC
GACTGTACCTACAACGCAGATGCGTTGCCGGCTCTTGTTGGTACTCTGACGGCTCTCAGTGCCGCAAACTCGAGA
CAGACACATGGCGGCCATGGCTTTATTACCAGAGTCTTGGTGGCAATGAAACCGCGCCATGCTTCTGAGAGGGCT
TTTTTCCATCTCATGGCAGCGCAAGGGTGGAAAGCCCTTGCAGAGACACTGGTCTTTCAGCTGCCAGAGATAGGG
CGCGAGAGCGGTTCAGTGGAGATGCATCTGTTTGAAAAGGAGCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail