Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|902
Gene name
LocationContig_1239:2297..4371
Strand+
Gene length (bp)2074
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00920 ILVD_EDD Dehydratase family 1.2E-199 61 591

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7UJ69|ILVD_RHOBA Dihydroxy-acid dehydratase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ilvD PE=3 SV=2 26 594 0.0E+00
sp|P39522|ILV3_YEAST Dihydroxy-acid dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV3 PE=1 SV=2 25 595 0.0E+00
sp|Q10318|ILV3_SCHPO Putative dihydroxy-acid dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.06c PE=2 SV=1 25 595 0.0E+00
sp|Q9LIR4|ILVD_ARATH Dihydroxy-acid dehydratase, chloroplastic OS=Arabidopsis thaliana GN=DHAD PE=1 SV=1 25 594 0.0E+00
sp|B2SH83|ILVD_FRATM Dihydroxy-acid dehydratase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ilvD PE=3 SV=1 26 594 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7UJ69|ILVD_RHOBA Dihydroxy-acid dehydratase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ilvD PE=3 SV=2 26 594 0.0E+00
sp|P39522|ILV3_YEAST Dihydroxy-acid dehydratase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV3 PE=1 SV=2 25 595 0.0E+00
sp|Q10318|ILV3_SCHPO Putative dihydroxy-acid dehydratase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.06c PE=2 SV=1 25 595 0.0E+00
sp|Q9LIR4|ILVD_ARATH Dihydroxy-acid dehydratase, chloroplastic OS=Arabidopsis thaliana GN=DHAD PE=1 SV=1 25 594 0.0E+00
sp|B2SH83|ILVD_FRATM Dihydroxy-acid dehydratase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ilvD PE=3 SV=1 26 594 0.0E+00
sp|B0TZC0|ILVD_FRAP2 Dihydroxy-acid dehydratase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=ilvD PE=3 SV=1 26 594 0.0E+00
sp|A4IYA1|ILVD_FRATW Dihydroxy-acid dehydratase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ilvD PE=3 SV=1 26 594 0.0E+00
sp|A0Q6R5|ILVD_FRATN Dihydroxy-acid dehydratase OS=Francisella tularensis subsp. novicida (strain U112) GN=ilvD PE=3 SV=1 26 594 0.0E+00
sp|Q5NH32|ILVD_FRATT Dihydroxy-acid dehydratase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ilvD PE=3 SV=1 26 587 0.0E+00
sp|Q14II4|ILVD_FRAT1 Dihydroxy-acid dehydratase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ilvD PE=3 SV=1 26 587 0.0E+00
sp|A6GWT7|ILVD_FLAPJ Dihydroxy-acid dehydratase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=ilvD PE=3 SV=1 26 594 0.0E+00
sp|Q11NN5|ILVD_CYTH3 Dihydroxy-acid dehydratase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ilvD PE=3 SV=1 25 594 0.0E+00
sp|Q02YY5|ILVD_LACLS Dihydroxy-acid dehydratase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ilvD PE=3 SV=1 25 594 0.0E+00
sp|A2RKQ9|ILVD_LACLM Dihydroxy-acid dehydratase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ilvD PE=3 SV=1 25 594 0.0E+00
sp|Q02139|ILVD_LACLA Dihydroxy-acid dehydratase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvD PE=3 SV=2 25 594 0.0E+00
sp|Q606D6|ILVD_METCA Dihydroxy-acid dehydratase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ilvD PE=3 SV=1 42 594 0.0E+00
sp|Q1QU47|ILVD_CHRSD Dihydroxy-acid dehydratase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ilvD PE=3 SV=1 35 596 8.0E-177
sp|Q3ID04|ILVD2_PSEHT Dihydroxy-acid dehydratase 2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ilvD2 PE=3 SV=1 25 596 2.0E-174
sp|A5CWQ3|ILVD_VESOH Dihydroxy-acid dehydratase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=ilvD PE=3 SV=1 19 594 4.0E-172
sp|A1AWH6|ILVD_RUTMC Dihydroxy-acid dehydratase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=ilvD PE=3 SV=1 28 594 1.0E-169
sp|Q053H5|ILVD_LEPBL Dihydroxy-acid dehydratase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=ilvD PE=3 SV=1 26 594 2.0E-167
sp|Q04RA5|ILVD_LEPBJ Dihydroxy-acid dehydratase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ilvD PE=3 SV=1 26 594 2.0E-167
sp|Q6F6Q0|ILVD2_ACIAD Dihydroxy-acid dehydratase 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ilvD2 PE=3 SV=1 42 594 8.0E-167
sp|Q2JTX6|ILVD_SYNJA Dihydroxy-acid dehydratase OS=Synechococcus sp. (strain JA-3-3Ab) GN=ilvD PE=3 SV=1 92 594 5.0E-166
sp|Q1IYZ8|ILVD_DEIGD Dihydroxy-acid dehydratase OS=Deinococcus geothermalis (strain DSM 11300) GN=ilvD PE=3 SV=1 25 594 3.0E-165
sp|Q72TC0|ILVD_LEPIC Dihydroxy-acid dehydratase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=ilvD PE=3 SV=1 23 594 4.0E-165
sp|Q8F219|ILVD_LEPIN Dihydroxy-acid dehydratase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=ilvD PE=3 SV=1 23 594 5.0E-165
sp|Q49UX2|ILVD2_STAS1 Dihydroxy-acid dehydratase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ilvD2 PE=3 SV=1 42 594 6.0E-165
sp|B0CEN4|ILVD_ACAM1 Dihydroxy-acid dehydratase OS=Acaryochloris marina (strain MBIC 11017) GN=ilvD PE=3 SV=1 27 594 7.0E-165
sp|Q2JK60|ILVD_SYNJB Dihydroxy-acid dehydratase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ilvD PE=3 SV=1 42 594 2.0E-164
sp|B8G762|ILVD_CHLAD Dihydroxy-acid dehydratase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ilvD PE=3 SV=1 98 594 1.0E-163
sp|B9LM83|ILVD_CHLSY Dihydroxy-acid dehydratase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=ilvD PE=3 SV=1 98 594 4.0E-163
sp|A9WF68|ILVD_CHLAA Dihydroxy-acid dehydratase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=ilvD PE=3 SV=1 98 594 4.0E-163
sp|Q8EN63|ILVD_OCEIH Dihydroxy-acid dehydratase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ilvD PE=3 SV=1 42 594 5.0E-163
sp|Q2YC67|ILVD_NITMU Dihydroxy-acid dehydratase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ilvD PE=3 SV=1 27 594 1.0E-162
sp|A5GTE2|ILVD_SYNR3 Dihydroxy-acid dehydratase OS=Synechococcus sp. (strain RCC307) GN=ilvD PE=3 SV=1 30 596 9.0E-161
sp|Q3AXL0|ILVD_SYNS9 Dihydroxy-acid dehydratase OS=Synechococcus sp. (strain CC9902) GN=ilvD PE=3 SV=1 42 596 7.0E-160
sp|B1WTN3|ILVD_CYAA5 Dihydroxy-acid dehydratase OS=Cyanothece sp. (strain ATCC 51142) GN=ilvD PE=3 SV=1 29 594 1.0E-159
sp|B7JXB4|ILVD_CYAP8 Dihydroxy-acid dehydratase OS=Cyanothece sp. (strain PCC 8801) GN=ilvD PE=3 SV=1 29 594 2.0E-159
sp|Q7U763|ILVD_SYNPX Dihydroxy-acid dehydratase OS=Synechococcus sp. (strain WH8102) GN=ilvD PE=3 SV=1 42 596 8.0E-159
sp|Q3AK67|ILVD_SYNSC Dihydroxy-acid dehydratase OS=Synechococcus sp. (strain CC9605) GN=ilvD PE=3 SV=1 42 594 1.0E-158
sp|Q0ADX6|ILVD_NITEC Dihydroxy-acid dehydratase OS=Nitrosomonas eutropha (strain C91) GN=ilvD PE=3 SV=1 27 594 1.0E-158
sp|Q8DK13|ILVD_THEEB Dihydroxy-acid dehydratase OS=Thermosynechococcus elongatus (strain BP-1) GN=ilvD PE=3 SV=1 42 594 1.0E-158
sp|P74689|ILVD_SYNY3 Dihydroxy-acid dehydratase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ilvD PE=3 SV=1 27 594 2.0E-158
sp|A1WTG1|ILVD_HALHL Dihydroxy-acid dehydratase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=ilvD PE=3 SV=1 27 595 3.0E-158
sp|Q82XY7|ILVD_NITEU Dihydroxy-acid dehydratase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ilvD PE=3 SV=1 27 594 3.0E-158
sp|Q7NGK1|ILVD_GLOVI Dihydroxy-acid dehydratase OS=Gloeobacter violaceus (strain PCC 7421) GN=ilvD PE=3 SV=1 92 595 3.0E-158
sp|A2CAC6|ILVD_PROM3 Dihydroxy-acid dehydratase OS=Prochlorococcus marinus (strain MIT 9303) GN=ilvD PE=3 SV=1 30 596 3.0E-157
sp|A8G4F2|ILVD_PROM2 Dihydroxy-acid dehydratase OS=Prochlorococcus marinus (strain MIT 9215) GN=ilvD PE=3 SV=1 42 594 4.0E-157
sp|Q7TV16|ILVD_PROMM Dihydroxy-acid dehydratase OS=Prochlorococcus marinus (strain MIT 9313) GN=ilvD PE=3 SV=1 30 596 6.0E-157
sp|A7NNA3|ILVD_ROSCS Dihydroxy-acid dehydratase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=ilvD PE=3 SV=1 26 596 7.0E-157
sp|Q4J860|ILVD_SULAC Dihydroxy-acid dehydratase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ilvD PE=3 SV=1 43 593 3.0E-155
sp|A5UY13|ILVD_ROSS1 Dihydroxy-acid dehydratase OS=Roseiflexus sp. (strain RS-1) GN=ilvD PE=3 SV=1 26 596 3.0E-155
sp|A2BW57|ILVD_PROM5 Dihydroxy-acid dehydratase OS=Prochlorococcus marinus (strain MIT 9515) GN=ilvD PE=3 SV=1 42 594 9.0E-155
sp|Q8YTE6|ILVD_NOSS1 Dihydroxy-acid dehydratase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ilvD PE=3 SV=1 27 594 2.0E-154
sp|B0JJP7|ILVD_MICAN Dihydroxy-acid dehydratase OS=Microcystis aeruginosa (strain NIES-843) GN=ilvD PE=3 SV=1 27 594 2.0E-154
sp|A1SM84|ILVD_NOCSJ Dihydroxy-acid dehydratase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=ilvD PE=3 SV=1 30 593 3.0E-154
sp|Q5Z0M2|ILVD1_NOCFA Dihydroxy-acid dehydratase 1 OS=Nocardia farcinica (strain IFM 10152) GN=ilvD1 PE=3 SV=1 26 594 1.0E-153
sp|A2BQQ9|ILVD_PROMS Dihydroxy-acid dehydratase OS=Prochlorococcus marinus (strain AS9601) GN=ilvD PE=3 SV=1 42 594 1.0E-153
sp|Q7VC95|ILVD_PROMA Dihydroxy-acid dehydratase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ilvD PE=3 SV=1 42 594 3.0E-153
sp|B2J456|ILVD_NOSP7 Dihydroxy-acid dehydratase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ilvD PE=3 SV=1 42 594 4.0E-153
sp|Q31BA3|ILVD_PROM9 Dihydroxy-acid dehydratase OS=Prochlorococcus marinus (strain MIT 9312) GN=ilvD PE=3 SV=1 42 594 7.0E-153
sp|Q46LF6|ILVD_PROMT Dihydroxy-acid dehydratase OS=Prochlorococcus marinus (strain NATL2A) GN=ilvD PE=3 SV=1 42 594 1.0E-152
sp|Q11AD1|ILVD_TRIEI Dihydroxy-acid dehydratase OS=Trichodesmium erythraeum (strain IMS101) GN=ilvD PE=3 SV=1 42 595 1.0E-152
sp|A3PCI2|ILVD_PROM0 Dihydroxy-acid dehydratase OS=Prochlorococcus marinus (strain MIT 9301) GN=ilvD PE=3 SV=1 42 594 2.0E-152
sp|Q7V1T1|ILVD_PROMP Dihydroxy-acid dehydratase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ilvD PE=3 SV=1 42 594 3.0E-152
sp|C1CNA5|ILVD_STRZP Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae (strain P1031) GN=ilvD PE=3 SV=1 31 594 8.0E-152
sp|C3MS47|ILVD_SULIM Dihydroxy-acid dehydratase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=ilvD PE=3 SV=1 43 593 9.0E-152
sp|C4KKJ8|ILVD_SULIK Dihydroxy-acid dehydratase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=ilvD PE=3 SV=1 43 593 9.0E-152
sp|C3N1G8|ILVD_SULIA Dihydroxy-acid dehydratase OS=Sulfolobus islandicus (strain M.16.27) GN=ilvD PE=3 SV=1 43 593 9.0E-152
sp|A9BAQ7|ILVD_PROM4 Dihydroxy-acid dehydratase OS=Prochlorococcus marinus (strain MIT 9211) GN=ilvD PE=3 SV=1 42 596 1.0E-151
sp|Q96YK0|ILVD_SULTO Dihydroxy-acid dehydratase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ilvD PE=3 SV=1 42 592 2.0E-151
sp|Q1ILZ0|ILVD_KORVE Dihydroxy-acid dehydratase OS=Koribacter versatilis (strain Ellin345) GN=ilvD PE=3 SV=1 42 593 4.0E-151
sp|C1CU32|ILVD_STRZT Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=ilvD PE=3 SV=1 42 594 6.0E-151
sp|C1CH59|ILVD_STRZJ Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae (strain JJA) GN=ilvD PE=3 SV=1 42 594 6.0E-151
sp|P65160|ILVD_STRR6 Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ilvD PE=3 SV=1 42 594 6.0E-151
sp|P65159|ILVD_STRPN Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ilvD PE=3 SV=1 42 594 6.0E-151
sp|B8ZPQ2|ILVD_STRPJ Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=ilvD PE=3 SV=1 42 594 6.0E-151
sp|B1I9U2|ILVD_STRPI Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=ilvD PE=3 SV=1 42 594 6.0E-151
sp|C1CAX1|ILVD_STRP7 Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae (strain 70585) GN=ilvD PE=3 SV=1 42 594 6.0E-151
sp|B5E3D3|ILVD_STRP4 Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=ilvD PE=3 SV=1 42 594 6.0E-151
sp|Q04I44|ILVD_STRP2 Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ilvD PE=3 SV=1 42 594 6.0E-151
sp|B2IN52|ILVD_STRPS Dihydroxy-acid dehydratase OS=Streptococcus pneumoniae (strain CGSP14) GN=ilvD PE=3 SV=1 42 594 8.0E-151
sp|A4VXL9|ILVD_STRSY Dihydroxy-acid dehydratase OS=Streptococcus suis (strain 05ZYH33) GN=ilvD PE=3 SV=1 42 594 9.0E-151
sp|A4W3W3|ILVD_STRS2 Dihydroxy-acid dehydratase OS=Streptococcus suis (strain 98HAH33) GN=ilvD PE=3 SV=1 42 594 9.0E-151
sp|Q97UB2|ILVD_SULSO Dihydroxy-acid dehydratase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ilvD PE=3 SV=1 43 593 2.0E-150
sp|C3N9R7|ILVD_SULIY Dihydroxy-acid dehydratase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=ilvD PE=3 SV=1 43 593 2.0E-150
sp|C3NLR8|ILVD_SULIN Dihydroxy-acid dehydratase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=ilvD PE=3 SV=1 43 593 2.0E-150
sp|A0QMH2|ILVD_MYCA1 Dihydroxy-acid dehydratase OS=Mycobacterium avium (strain 104) GN=ilvD PE=3 SV=1 30 592 4.0E-150
sp|Q5P8J4|ILVD1_AROAE Dihydroxy-acid dehydratase 1 OS=Aromatoleum aromaticum (strain EbN1) GN=ilvD1 PE=3 SV=1 25 594 4.0E-150
sp|C3MKM4|ILVD_SULIL Dihydroxy-acid dehydratase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=ilvD PE=3 SV=1 43 593 4.0E-150
sp|B1XVE9|ILVD_POLNS Dihydroxy-acid dehydratase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ilvD PE=3 SV=1 25 594 5.0E-150
sp|Q73TT7|ILVD_MYCPA Dihydroxy-acid dehydratase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ilvD PE=3 SV=1 30 592 1.0E-149
sp|Q5NY71|ILVD3_AROAE Dihydroxy-acid dehydratase 3 OS=Aromatoleum aromaticum (strain EbN1) GN=ilvD3 PE=3 SV=1 25 594 3.0E-149
sp|Q83HI6|ILVD_TROW8 Dihydroxy-acid dehydratase OS=Tropheryma whipplei (strain TW08/27) GN=ilvD PE=3 SV=1 42 593 8.0E-149
sp|Q83GP9|ILVD_TROWT Dihydroxy-acid dehydratase OS=Tropheryma whipplei (strain Twist) GN=ilvD PE=3 SV=1 42 593 1.0E-148
sp|Q5M334|ILVD_STRT2 Dihydroxy-acid dehydratase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ilvD PE=3 SV=1 42 594 1.0E-148
sp|Q5LYH1|ILVD_STRT1 Dihydroxy-acid dehydratase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ilvD PE=3 SV=1 42 594 1.0E-148
sp|A0LSR8|ILVD_ACIC1 Dihydroxy-acid dehydratase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ilvD PE=3 SV=1 26 592 1.0E-148
sp|A4YEN4|ILVD_METS5 Dihydroxy-acid dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=ilvD PE=3 SV=1 42 592 3.0E-148
sp|Q12BW0|ILVD_POLSJ Dihydroxy-acid dehydratase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ilvD PE=3 SV=1 25 594 4.0E-148
sp|A4SWN4|ILVD_POLSQ Dihydroxy-acid dehydratase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ilvD PE=3 SV=1 25 594 5.0E-148
sp|A0PMV4|ILVD_MYCUA Dihydroxy-acid dehydratase OS=Mycobacterium ulcerans (strain Agy99) GN=ilvD PE=3 SV=1 22 592 1.0E-147
sp|Q7WFQ5|ILVD3_BORBR Dihydroxy-acid dehydratase 3 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ilvD3 PE=3 SV=1 30 595 2.0E-147
sp|A5CPY3|ILVD_CLAM3 Dihydroxy-acid dehydratase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=ilvD PE=3 SV=1 30 593 4.0E-147
sp|Q6AEN9|ILVD_LEIXX Dihydroxy-acid dehydratase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=ilvD PE=3 SV=1 42 593 5.0E-147
sp|O06069|ILVD_MYCLE Dihydroxy-acid dehydratase OS=Mycobacterium leprae (strain TN) GN=ilvD PE=3 SV=1 20 592 5.0E-147
sp|Q7W497|ILVD2_BORPA Dihydroxy-acid dehydratase 2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ilvD2 PE=3 SV=2 30 595 7.0E-147
sp|B0RIN3|ILVD_CLAMS Dihydroxy-acid dehydratase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=ilvD PE=3 SV=1 30 593 8.0E-147
sp|A3CR42|ILVD_STRSV Dihydroxy-acid dehydratase OS=Streptococcus sanguinis (strain SK36) GN=ilvD PE=3 SV=1 42 594 3.0E-146
sp|A9WP05|ILVD_RENSM Dihydroxy-acid dehydratase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=ilvD PE=3 SV=1 42 591 8.0E-146
sp|A3PSS2|ILVD_MYCSJ Dihydroxy-acid dehydratase OS=Mycobacterium sp. (strain JLS) GN=ilvD PE=3 SV=1 30 592 3.0E-145
sp|Q8FMR1|ILVD2_COREF Dihydroxy-acid dehydratase 2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ilvD2 PE=3 SV=1 30 592 1.0E-144
sp|B1Y816|ILVD_LEPCP Dihydroxy-acid dehydratase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ilvD PE=3 SV=1 26 594 1.0E-144
sp|A0JXZ9|ILVD_ARTS2 Dihydroxy-acid dehydratase OS=Arthrobacter sp. (strain FB24) GN=ilvD PE=3 SV=1 59 591 3.0E-144
sp|A1WMU5|ILVD_VEREI Dihydroxy-acid dehydratase OS=Verminephrobacter eiseniae (strain EF01-2) GN=ilvD PE=3 SV=1 26 595 3.0E-144
sp|P9WKJ5|ILVD_MYCTU Dihydroxy-acid dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvD PE=1 SV=1 30 592 4.0E-144
sp|P9WKJ4|ILVD_MYCTO Dihydroxy-acid dehydratase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvD PE=3 SV=1 30 592 4.0E-144
sp|P65155|ILVD_MYCBO Dihydroxy-acid dehydratase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvD PE=3 SV=1 30 592 4.0E-144
sp|A1VR98|ILVD_POLNA Dihydroxy-acid dehydratase OS=Polaromonas naphthalenivorans (strain CJ2) GN=ilvD PE=3 SV=1 26 594 4.0E-144
sp|A2SFL0|ILVD_METPP Dihydroxy-acid dehydratase OS=Methylibium petroleiphilum (strain PM1) GN=ilvD PE=3 SV=1 26 594 1.0E-143
sp|Q8DRT7|ILVD_STRMU Dihydroxy-acid dehydratase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ilvD PE=3 SV=1 42 594 2.0E-143
sp|Q21X56|ILVD_RHOFT Dihydroxy-acid dehydratase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ilvD PE=3 SV=1 26 594 3.0E-143
sp|A4G341|ILVD_HERAR Dihydroxy-acid dehydratase OS=Herminiimonas arsenicoxydans GN=ilvD PE=3 SV=1 26 593 1.0E-142
sp|Q7VUN6|ILVD2_BORPE Dihydroxy-acid dehydratase 2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ilvD2 PE=3 SV=1 30 595 1.0E-142
sp|Q8XWR1|ILVD_RALSO Dihydroxy-acid dehydratase OS=Ralstonia solanacearum (strain GMI1000) GN=ilvD PE=3 SV=1 27 594 2.0E-142
sp|Q475B2|ILVD1_CUPPJ Dihydroxy-acid dehydratase 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ilvD1 PE=3 SV=1 26 594 7.0E-141
sp|Q6KZ30|ILVD_PICTO Dihydroxy-acid dehydratase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=ilvD PE=3 SV=1 63 594 8.0E-141
sp|Q2T0B6|ILVD_BURTA Dihydroxy-acid dehydratase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ilvD PE=3 SV=1 27 593 1.0E-140
sp|A7HXI4|ILVD_PARL1 Dihydroxy-acid dehydratase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=ilvD PE=3 SV=1 43 593 2.0E-140
sp|A6SVP5|ILVD_JANMA Dihydroxy-acid dehydratase OS=Janthinobacterium sp. (strain Marseille) GN=ilvD PE=3 SV=1 26 593 2.0E-140
sp|A3NSI6|ILVD_BURP0 Dihydroxy-acid dehydratase OS=Burkholderia pseudomallei (strain 1106a) GN=ilvD PE=3 SV=1 27 593 6.0E-140
sp|A3MUK8|ILVD_PYRCJ Dihydroxy-acid dehydratase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=ilvD PE=3 SV=1 59 593 7.0E-140
sp|Q63WB9|ILVD_BURPS Dihydroxy-acid dehydratase OS=Burkholderia pseudomallei (strain K96243) GN=ilvD PE=3 SV=1 27 593 2.0E-139
sp|A3N6U9|ILVD_BURP6 Dihydroxy-acid dehydratase OS=Burkholderia pseudomallei (strain 668) GN=ilvD PE=3 SV=1 27 593 2.0E-139
sp|A1V5Z0|ILVD_BURMS Dihydroxy-acid dehydratase OS=Burkholderia mallei (strain SAVP1) GN=ilvD PE=3 SV=1 27 593 2.0E-139
sp|Q62LG7|ILVD_BURMA Dihydroxy-acid dehydratase OS=Burkholderia mallei (strain ATCC 23344) GN=ilvD PE=3 SV=1 27 593 2.0E-139
sp|A2SAC7|ILVD_BURM9 Dihydroxy-acid dehydratase OS=Burkholderia mallei (strain NCTC 10229) GN=ilvD PE=3 SV=1 27 593 2.0E-139
sp|A3MLQ5|ILVD_BURM7 Dihydroxy-acid dehydratase OS=Burkholderia mallei (strain NCTC 10247) GN=ilvD PE=3 SV=1 27 593 2.0E-139
sp|Q3JV12|ILVD_BURP1 Dihydroxy-acid dehydratase OS=Burkholderia pseudomallei (strain 1710b) GN=ilvD PE=3 SV=1 27 593 3.0E-139
sp|Q98LB3|ILVD2_RHILO Dihydroxy-acid dehydratase 2 OS=Rhizobium loti (strain MAFF303099) GN=ilvD2 PE=3 SV=1 43 593 5.0E-138
sp|A3DIY3|ILVD_CLOTH Dihydroxy-acid dehydratase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ilvD PE=3 SV=1 43 594 6.0E-138
sp|Q39DS9|ILVD2_BURL3 Dihydroxy-acid dehydratase 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ilvD2 PE=3 SV=1 27 593 2.0E-137
sp|B1YBN8|ILVD_PYRNV Dihydroxy-acid dehydratase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=ilvD PE=3 SV=1 59 596 2.0E-137
sp|A4WN46|ILVD_PYRAR Dihydroxy-acid dehydratase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=ilvD PE=3 SV=1 55 593 2.0E-137
sp|B2UYT6|ILVD_CLOBA Dihydroxy-acid dehydratase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=ilvD PE=3 SV=1 42 592 4.0E-137
sp|Q9YG88|ILVD_AERPE Dihydroxy-acid dehydratase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=ilvD PE=3 SV=3 61 593 2.0E-136
sp|A1RSI5|ILVD_PYRIL Dihydroxy-acid dehydratase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=ilvD PE=3 SV=1 59 596 2.0E-136
sp|B8I5A9|ILVD_CLOCE Dihydroxy-acid dehydratase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ilvD PE=3 SV=1 61 592 2.0E-136
sp|B2TIR2|ILVD_CLOBB Dihydroxy-acid dehydratase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=ilvD PE=3 SV=1 42 592 6.0E-136
sp|A4XHR9|ILVD_CALS8 Dihydroxy-acid dehydratase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=ilvD PE=3 SV=1 61 594 8.0E-136
sp|Q89KY5|ILVD2_BRADU Dihydroxy-acid dehydratase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ilvD2 PE=3 SV=1 43 593 4.0E-135
sp|B9MPM8|ILVD_CALBD Dihydroxy-acid dehydratase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ilvD PE=3 SV=1 61 594 2.0E-134
sp|Q4FM19|ILVD_PELUB Dihydroxy-acid dehydratase OS=Pelagibacter ubique (strain HTCC1062) GN=ilvD PE=3 SV=1 25 593 3.0E-134
sp|Q5KYA5|ILVD_GEOKA Dihydroxy-acid dehydratase OS=Geobacillus kaustophilus (strain HTA426) GN=ilvD PE=3 SV=1 27 592 4.0E-133
sp|A7GNQ7|ILVD_BACCN Dihydroxy-acid dehydratase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ilvD PE=3 SV=1 30 592 5.0E-133
sp|Q3IMV2|ILVD_NATPD Dihydroxy-acid dehydratase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ilvD PE=3 SV=1 43 594 7.0E-133
sp|A8LKN5|ILVD_DINSH Dihydroxy-acid dehydratase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ilvD PE=3 SV=1 30 593 4.0E-132
sp|Q58672|ILVD_METJA Dihydroxy-acid dehydratase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvD PE=3 SV=2 42 592 2.0E-131
sp|Q8ZYU6|ILVD_PYRAE Dihydroxy-acid dehydratase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=ilvD PE=3 SV=1 59 596 1.0E-130
sp|A6UUU2|ILVD_META3 Dihydroxy-acid dehydratase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=ilvD PE=3 SV=1 30 592 3.0E-130
sp|B7HIP0|ILVD_BACC4 Dihydroxy-acid dehydratase OS=Bacillus cereus (strain B4264) GN=ilvD PE=3 SV=1 30 596 5.0E-130
sp|Q81F26|ILVD_BACCR Dihydroxy-acid dehydratase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ilvD PE=3 SV=2 30 596 5.0E-130
sp|A9VPN7|ILVD_BACWK Dihydroxy-acid dehydratase OS=Bacillus weihenstephanensis (strain KBAB4) GN=ilvD PE=3 SV=1 30 596 8.0E-130
sp|A7Z5T7|ILVD_BACMF Dihydroxy-acid dehydratase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ilvD PE=3 SV=1 30 592 1.0E-129
sp|B7JJG8|ILVD_BACC0 Dihydroxy-acid dehydratase OS=Bacillus cereus (strain AH820) GN=ilvD PE=3 SV=1 30 596 2.0E-129
sp|Q2RG93|ILVD_MOOTA Dihydroxy-acid dehydratase OS=Moorella thermoacetica (strain ATCC 39073) GN=ilvD PE=3 SV=1 43 594 4.0E-129
sp|Q7WJP7|ILVD2_BORBR Dihydroxy-acid dehydratase 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ilvD2 PE=3 SV=1 63 593 4.0E-129
sp|Q9XBI3|ILVD_BACC1 Dihydroxy-acid dehydratase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ilvD PE=3 SV=2 30 596 4.0E-129
sp|C1EPL6|ILVD_BACC3 Dihydroxy-acid dehydratase OS=Bacillus cereus (strain 03BB102) GN=ilvD PE=3 SV=1 30 596 6.0E-129
sp|A0RCL3|ILVD_BACAH Dihydroxy-acid dehydratase OS=Bacillus thuringiensis (strain Al Hakam) GN=ilvD PE=3 SV=1 30 596 6.0E-129
sp|Q6HKA0|ILVD_BACHK Dihydroxy-acid dehydratase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ilvD PE=3 SV=1 30 596 7.0E-129
sp|B9IX72|ILVD_BACCQ Dihydroxy-acid dehydratase OS=Bacillus cereus (strain Q1) GN=ilvD PE=3 SV=1 30 596 7.0E-129
sp|B7HMM7|ILVD_BACC7 Dihydroxy-acid dehydratase OS=Bacillus cereus (strain AH187) GN=ilvD PE=3 SV=1 30 596 8.0E-129
sp|Q3AER0|ILVD_CARHZ Dihydroxy-acid dehydratase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=ilvD PE=3 SV=1 43 592 9.0E-129
sp|Q81S26|ILVD_BACAN Dihydroxy-acid dehydratase OS=Bacillus anthracis GN=ilvD PE=3 SV=1 30 596 1.0E-128
sp|C3L6P6|ILVD_BACAC Dihydroxy-acid dehydratase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ilvD PE=3 SV=1 30 596 1.0E-128
sp|C3P6S2|ILVD_BACAA Dihydroxy-acid dehydratase OS=Bacillus anthracis (strain A0248) GN=ilvD PE=3 SV=1 30 596 1.0E-128
sp|B7IS44|ILVD_BACC2 Dihydroxy-acid dehydratase OS=Bacillus cereus (strain G9842) GN=ilvD PE=3 SV=1 30 596 4.0E-128
sp|B5YKD5|ILVD_THEYD Dihydroxy-acid dehydratase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=ilvD PE=3 SV=1 43 594 5.0E-128
sp|P51785|ILVD_BACSU Dihydroxy-acid dehydratase OS=Bacillus subtilis (strain 168) GN=ilvD PE=1 SV=4 30 592 7.0E-128
sp|Q63CV3|ILVD_BACCZ Dihydroxy-acid dehydratase OS=Bacillus cereus (strain ZK / E33L) GN=ilvD PE=3 SV=1 30 596 7.0E-128
sp|C0QUI2|ILVD_PERMH Dihydroxy-acid dehydratase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=ilvD PE=3 SV=1 43 592 2.0E-127
sp|Q5V545|ILVD_HALMA Dihydroxy-acid dehydratase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ilvD PE=3 SV=1 30 594 2.0E-127
sp|A5N8V4|ILVD_CLOK5 Dihydroxy-acid dehydratase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=ilvD PE=3 SV=1 42 596 3.0E-127
sp|B9E299|ILVD_CLOK1 Dihydroxy-acid dehydratase OS=Clostridium kluyveri (strain NBRC 12016) GN=ilvD PE=3 SV=1 42 596 3.0E-127
sp|Q8U297|ILVD_PYRFU Dihydroxy-acid dehydratase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=ilvD PE=3 SV=1 61 592 3.0E-127
sp|B3E5X8|ILVD_GEOLS Dihydroxy-acid dehydratase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=ilvD PE=3 SV=1 43 595 3.0E-127
sp|Q65IB0|ILVD_BACLD Dihydroxy-acid dehydratase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ilvD PE=3 SV=1 30 592 3.0E-127
sp|A4SFC2|ILVD_CHLPM Dihydroxy-acid dehydratase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=ilvD PE=3 SV=1 43 596 6.0E-127
sp|A6LTK6|ILVD_CLOB8 Dihydroxy-acid dehydratase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=ilvD PE=3 SV=1 42 596 7.0E-127
sp|Q9K8E4|ILVD_BACHD Dihydroxy-acid dehydratase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ilvD PE=3 SV=1 43 592 1.0E-126
sp|Q3APB9|ILVD_CHLCH Dihydroxy-acid dehydratase OS=Chlorobium chlorochromatii (strain CaD3) GN=ilvD PE=3 SV=1 43 592 1.0E-126
sp|Q74BW7|ILVD_GEOSL Dihydroxy-acid dehydratase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ilvD PE=3 SV=1 43 595 2.0E-126
sp|A9KT71|ILVD_CLOPH Dihydroxy-acid dehydratase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ilvD PE=3 SV=1 61 596 3.0E-126
sp|B4SDK2|ILVD_PELPB Dihydroxy-acid dehydratase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ilvD PE=3 SV=1 43 596 5.0E-126
sp|A1BES8|ILVD_CHLPD Dihydroxy-acid dehydratase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=ilvD PE=3 SV=1 30 592 5.0E-126
sp|Q9UZ03|ILVD_PYRAB Dihydroxy-acid dehydratase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ilvD PE=3 SV=1 43 592 6.0E-126
sp|C4ZAW6|ILVD_EUBR3 Dihydroxy-acid dehydratase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=ilvD PE=3 SV=1 46 596 7.0E-126
sp|Q5WEM9|ILVD_BACSK Dihydroxy-acid dehydratase OS=Bacillus clausii (strain KSM-K16) GN=ilvD PE=3 SV=1 43 592 8.0E-126
sp|Q3A3A5|ILVD_PELCD Dihydroxy-acid dehydratase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ilvD PE=3 SV=1 28 595 1.0E-125
sp|B3QMA2|ILVD_CHLP8 Dihydroxy-acid dehydratase OS=Chlorobaculum parvum (strain NCIB 8327) GN=ilvD PE=3 SV=1 43 592 3.0E-125
sp|Q8KER4|ILVD_CHLTE Dihydroxy-acid dehydratase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=ilvD PE=3 SV=1 43 592 1.0E-124
sp|Q5SIY0|ILVD_THET8 Dihydroxy-acid dehydratase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ilvD PE=3 SV=1 42 596 2.0E-124
sp|B3EHP3|ILVD_CHLL2 Dihydroxy-acid dehydratase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=ilvD PE=3 SV=1 43 596 4.0E-124
sp|Q89HA2|ILVD3_BRADU Dihydroxy-acid dehydratase 3 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ilvD3 PE=3 SV=1 55 593 6.0E-124
sp|B9M5B4|ILVD_GEODF Dihydroxy-acid dehydratase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=ilvD PE=3 SV=1 43 595 6.0E-124
sp|Q8Q078|ILVD_METMA Dihydroxy-acid dehydratase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=ilvD PE=3 SV=1 42 594 1.0E-123
sp|A1AS43|ILVD_PELPD Dihydroxy-acid dehydratase OS=Pelobacter propionicus (strain DSM 2379) GN=ilvD PE=3 SV=1 30 595 2.0E-123
sp|Q39W79|ILVD_GEOMG Dihydroxy-acid dehydratase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=ilvD PE=3 SV=1 43 595 4.0E-123
sp|C6E521|ILVD_GEOSM Dihydroxy-acid dehydratase OS=Geobacter sp. (strain M21) GN=ilvD PE=3 SV=1 43 595 4.0E-123
sp|A5G7V6|ILVD_GEOUR Dihydroxy-acid dehydratase OS=Geobacter uraniireducens (strain Rf4) GN=ilvD PE=3 SV=1 43 595 5.0E-123
sp|Q725Q1|ILVD_DESVH Dihydroxy-acid dehydratase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ilvD PE=3 SV=1 43 591 6.0E-123
sp|Q2LXP6|ILVD_SYNAS Dihydroxy-acid dehydratase OS=Syntrophus aciditrophicus (strain SB) GN=ilvD PE=3 SV=1 61 592 6.0E-123
sp|O67009|ILVD_AQUAE Dihydroxy-acid dehydratase OS=Aquifex aeolicus (strain VF5) GN=ilvD PE=3 SV=1 43 595 7.0E-123
sp|B4U6Z8|ILVD_HYDS0 Dihydroxy-acid dehydratase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ilvD PE=3 SV=1 30 595 7.0E-123
sp|B5EHV2|ILVD_GEOBB Dihydroxy-acid dehydratase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ilvD PE=3 SV=1 43 595 8.0E-123
sp|Q72JA8|ILVD_THET2 Dihydroxy-acid dehydratase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ilvD PE=3 SV=1 42 596 9.0E-123
sp|A8Z4V6|ILVD_STAAT Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ilvD PE=3 SV=1 37 596 2.0E-122
sp|Q2FF71|ILVD_STAA3 Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain USA300) GN=ilvD PE=3 SV=1 37 596 2.0E-122
sp|B9DMJ2|ILVD_STACT Dihydroxy-acid dehydratase OS=Staphylococcus carnosus (strain TM300) GN=ilvD PE=3 SV=1 42 596 2.0E-122
sp|B3QSP3|ILVD_CHLT3 Dihydroxy-acid dehydratase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=ilvD PE=3 SV=1 43 592 3.0E-122
sp|B9EBF6|ILVD_MACCJ Dihydroxy-acid dehydratase OS=Macrococcus caseolyticus (strain JCSC5402) GN=ilvD PE=3 SV=1 42 596 7.0E-122
sp|P65158|ILVD_STAAW Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain MW2) GN=ilvD PE=3 SV=1 37 596 1.0E-121
sp|Q6G7Q4|ILVD_STAAS Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain MSSA476) GN=ilvD PE=3 SV=1 37 596 1.0E-121
sp|P65157|ILVD_STAAN Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain N315) GN=ilvD PE=3 SV=1 37 596 1.0E-121
sp|P65156|ILVD_STAAM Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ilvD PE=3 SV=1 37 596 1.0E-121
sp|A5IUJ9|ILVD_STAA9 Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain JH9) GN=ilvD PE=3 SV=1 37 596 1.0E-121
sp|Q2FWK7|ILVD_STAA8 Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain NCTC 8325) GN=ilvD PE=3 SV=1 37 596 1.0E-121
sp|A6U3D8|ILVD_STAA2 Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain JH1) GN=ilvD PE=3 SV=1 37 596 1.0E-121
sp|A7X4M5|ILVD_STAA1 Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ilvD PE=3 SV=1 37 596 1.0E-121
sp|A1V9E1|ILVD_DESVV Dihydroxy-acid dehydratase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ilvD PE=3 SV=1 43 591 2.0E-121
sp|A0LF54|ILVD_SYNFM Dihydroxy-acid dehydratase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=ilvD PE=3 SV=1 61 592 2.0E-121
sp|Q2YUF6|ILVD_STAAB Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ilvD PE=3 SV=1 37 596 2.0E-121
sp|Q67KX6|ILVD_SYMTH Dihydroxy-acid dehydratase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ilvD PE=3 SV=1 43 596 2.0E-121
sp|Q46AU2|ILVD_METBF Dihydroxy-acid dehydratase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=ilvD PE=3 SV=1 42 594 4.0E-121
sp|A6URV4|ILVD_METVS Dihydroxy-acid dehydratase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=ilvD PE=3 SV=1 42 592 6.0E-121
sp|A8FEC5|ILVD_BACP2 Dihydroxy-acid dehydratase OS=Bacillus pumilus (strain SAFR-032) GN=ilvD PE=3 SV=1 43 592 7.0E-121
sp|Q8CNL6|ILVD_STAES Dihydroxy-acid dehydratase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ilvD PE=3 SV=1 37 596 8.0E-121
sp|Q5HMG3|ILVD_STAEQ Dihydroxy-acid dehydratase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ilvD PE=3 SV=1 37 596 8.0E-121
sp|A6QIQ0|ILVD_STAAE Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain Newman) GN=ilvD PE=3 SV=1 37 596 2.0E-120
sp|Q5HEE8|ILVD_STAAC Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain COL) GN=ilvD PE=3 SV=1 37 596 2.0E-120
sp|Q8RDJ9|ILVD_CALS4 Dihydroxy-acid dehydratase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=ilvD PE=3 SV=1 43 592 2.0E-120
sp|Q6GF19|ILVD_STAAR Dihydroxy-acid dehydratase OS=Staphylococcus aureus (strain MRSA252) GN=ilvD PE=3 SV=1 37 596 2.0E-120
sp|A7I7L0|ILVD_METB6 Dihydroxy-acid dehydratase OS=Methanoregula boonei (strain 6A8) GN=ilvD PE=3 SV=1 30 592 3.0E-120
sp|B8DMM1|ILVD_DESVM Dihydroxy-acid dehydratase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=ilvD PE=3 SV=1 43 592 4.0E-120
sp|A8AB39|ILVD_IGNH4 Dihydroxy-acid dehydratase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=ilvD PE=3 SV=1 61 590 6.0E-120
sp|B2VAB3|ILVD_SULSY Dihydroxy-acid dehydratase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=ilvD PE=3 SV=1 43 592 7.0E-120
sp|Q8TPV2|ILVD1_METAC Dihydroxy-acid dehydratase 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ilvD1 PE=3 SV=1 42 594 7.0E-120
sp|Q03UL2|ILVD_LEUMM Dihydroxy-acid dehydratase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ilvD PE=3 SV=1 26 592 1.0E-119
sp|Q49Z08|ILVD1_STAS1 Dihydroxy-acid dehydratase 1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ilvD1 PE=3 SV=1 42 596 5.0E-119
sp|Q97EE3|ILVD_CLOAB Dihydroxy-acid dehydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ilvD PE=3 SV=1 61 592 7.0E-119
sp|A0Q0E8|ILVD_CLONN Dihydroxy-acid dehydratase OS=Clostridium novyi (strain NT) GN=ilvD PE=3 SV=1 43 594 8.0E-119
sp|Q4L7T6|ILVD_STAHJ Dihydroxy-acid dehydratase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ilvD PE=3 SV=1 37 596 8.0E-119
sp|B1I250|ILVD_DESAP Dihydroxy-acid dehydratase OS=Desulforudis audaxviator (strain MP104C) GN=ilvD PE=3 SV=1 43 592 9.0E-119
sp|A8ZTQ7|ILVD_DESOH Dihydroxy-acid dehydratase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=ilvD PE=3 SV=1 61 592 1.0E-118
sp|A3CU68|ILVD_METMJ Dihydroxy-acid dehydratase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ilvD PE=3 SV=1 30 592 3.0E-118
sp|Q317H9|ILVD_DESAG Dihydroxy-acid dehydratase OS=Desulfovibrio alaskensis (strain G20) GN=ilvD PE=3 SV=1 43 592 3.0E-118
sp|C4Z566|ILVD_EUBE2 Dihydroxy-acid dehydratase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=ilvD PE=3 SV=1 42 592 4.0E-118
sp|A6VIV7|ILVD_METM7 Dihydroxy-acid dehydratase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=ilvD PE=3 SV=1 42 592 2.0E-117
sp|Q2NE10|ILVD_METST Dihydroxy-acid dehydratase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ilvD PE=3 SV=1 30 592 3.0E-117
sp|Q3B589|ILVD_CHLL7 Dihydroxy-acid dehydratase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ilvD PE=3 SV=1 43 596 7.0E-117
sp|B8CX17|ILVD_HALOH Dihydroxy-acid dehydratase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ilvD PE=3 SV=1 30 594 8.0E-117
sp|A4FZM0|ILVD_METM5 Dihydroxy-acid dehydratase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=ilvD PE=3 SV=1 42 592 8.0E-117
sp|O29248|ILVD_ARCFU Dihydroxy-acid dehydratase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ilvD PE=3 SV=1 30 591 1.0E-115
sp|B1GYS7|ILVD_UNCTG Dihydroxy-acid dehydratase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ilvD PE=3 SV=1 42 592 1.0E-115
sp|C4XT34|ILVD_DESMR Dihydroxy-acid dehydratase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=ilvD PE=3 SV=1 43 596 2.0E-115
sp|B8FHH7|ILVD_DESAA Dihydroxy-acid dehydratase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=ilvD PE=3 SV=1 75 593 2.0E-115
sp|A0AK88|ILVD_LISW6 Dihydroxy-acid dehydratase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=ilvD PE=3 SV=1 42 596 4.0E-115
sp|Q8TKM8|ILVD2_METAC Dihydroxy-acid dehydratase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ilvD2 PE=3 SV=1 42 594 5.0E-115
sp|Q9WZ21|ILVD_THEMA Dihydroxy-acid dehydratase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ilvD PE=3 SV=1 43 596 7.0E-115
sp|Q71Y38|ILVD_LISMF Dihydroxy-acid dehydratase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ilvD PE=3 SV=1 42 596 8.0E-115
sp|C1KWS7|ILVD_LISMC Dihydroxy-acid dehydratase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=ilvD PE=3 SV=1 42 596 8.0E-115
sp|A0B6Y9|ILVD_METTP Dihydroxy-acid dehydratase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=ilvD PE=3 SV=1 43 592 9.0E-115
sp|A5IJM4|ILVD_THEP1 Dihydroxy-acid dehydratase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=ilvD PE=3 SV=1 43 596 2.0E-114
sp|O27498|ILVD_METTH Dihydroxy-acid dehydratase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ilvD PE=3 SV=2 61 592 2.0E-114
sp|Q8Y5S2|ILVD_LISMO Dihydroxy-acid dehydratase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ilvD PE=3 SV=1 42 596 2.0E-114
sp|B8DBU8|ILVD_LISMH Dihydroxy-acid dehydratase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=ilvD PE=3 SV=1 42 596 2.0E-114
sp|Q3ZXH9|ILVD_DEHMC Dihydroxy-acid dehydratase OS=Dehalococcoides mccartyi (strain CBDB1) GN=ilvD PE=3 SV=1 43 592 2.0E-114
sp|A9A6N6|ILVD_METM6 Dihydroxy-acid dehydratase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=ilvD PE=3 SV=1 42 592 3.0E-114
sp|Q92A32|ILVD_LISIN Dihydroxy-acid dehydratase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ilvD PE=3 SV=1 42 596 3.0E-114
sp|B1L8U4|ILVD_THESQ Dihydroxy-acid dehydratase OS=Thermotoga sp. (strain RQ2) GN=ilvD PE=3 SV=1 43 596 4.0E-114
sp|Q6M0F3|ILVD_METMP Dihydroxy-acid dehydratase OS=Methanococcus maripaludis (strain S2 / LL) GN=ilvD PE=3 SV=1 42 592 1.0E-113
sp|A5UML4|ILVD_METS3 Dihydroxy-acid dehydratase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=ilvD PE=3 SV=1 61 592 2.0E-113
sp|A5FR35|ILVD_DEHMB Dihydroxy-acid dehydratase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=ilvD PE=3 SV=1 43 592 2.0E-113
sp|B4UI29|ILVD_ANASK Dihydroxy-acid dehydratase OS=Anaeromyxobacter sp. (strain K) GN=ilvD PE=3 SV=1 61 592 3.0E-113
sp|B8JAT1|ILVD_ANAD2 Dihydroxy-acid dehydratase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ilvD PE=3 SV=1 61 592 8.0E-113
sp|Q2IH17|ILVD_ANADE Dihydroxy-acid dehydratase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=ilvD PE=3 SV=1 61 592 5.0E-112
sp|A8EWJ4|ILVD_ARCB4 Dihydroxy-acid dehydratase OS=Arcobacter butzleri (strain RM4018) GN=ilvD PE=3 SV=1 30 592 6.0E-112
sp|Q9PJ98|ILVD_CAMJE Dihydroxy-acid dehydratase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ilvD PE=3 SV=1 42 594 2.0E-111
sp|Q2FMZ1|ILVD_METHJ Dihydroxy-acid dehydratase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ilvD PE=3 SV=2 42 592 3.0E-111
sp|B9KE56|ILVD_CAMLR Dihydroxy-acid dehydratase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=ilvD PE=3 SV=1 42 594 3.0E-111
sp|Q12TW7|ILVD_METBU Dihydroxy-acid dehydratase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=ilvD PE=3 SV=1 42 594 4.0E-111
sp|Q3Z888|ILVD_DEHM1 Dihydroxy-acid dehydratase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=ilvD PE=3 SV=1 43 592 6.0E-111
sp|A8FJH6|ILVD_CAMJ8 Dihydroxy-acid dehydratase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=ilvD PE=3 SV=1 30 594 5.0E-110
sp|Q5HXE4|ILVD_CAMJR Dihydroxy-acid dehydratase OS=Campylobacter jejuni (strain RM1221) GN=ilvD PE=3 SV=1 30 594 7.0E-110
sp|B9L6Y0|ILVD_NAUPA Dihydroxy-acid dehydratase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=ilvD PE=3 SV=1 61 595 9.0E-110
sp|C6BUM7|ILVD_DESAD Dihydroxy-acid dehydratase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=ilvD PE=3 SV=1 43 592 3.0E-109
sp|A7H1A6|ILVD_CAMJD Dihydroxy-acid dehydratase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=ilvD PE=3 SV=1 42 594 6.0E-109
sp|A6QD02|ILVD_SULNB Dihydroxy-acid dehydratase OS=Sulfurovum sp. (strain NBC37-1) GN=ilvD PE=3 SV=1 30 595 3.0E-108
sp|A1VX91|ILVD_CAMJJ Dihydroxy-acid dehydratase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=ilvD PE=3 SV=1 42 594 5.0E-108
sp|B8FU95|ILVD_DESHD Dihydroxy-acid dehydratase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=ilvD PE=3 SV=1 43 591 5.0E-108
sp|Q30UI5|ILVD_SULDN Dihydroxy-acid dehydratase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=ilvD PE=3 SV=1 30 592 2.0E-107
sp|B2UR52|ILVD_AKKM8 Dihydroxy-acid dehydratase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ilvD PE=3 SV=1 59 592 5.0E-107
sp|Q7MAN4|ILVD_WOLSU Dihydroxy-acid dehydratase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ilvD PE=3 SV=1 43 592 2.0E-106
sp|Q8KTS9|ILVD_TREPR Dihydroxy-acid dehydratase OS=Tremblaya princeps GN=ilvD PE=3 SV=1 85 592 6.0E-106
sp|Q7VHW3|ILVD_HELHP Dihydroxy-acid dehydratase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ilvD PE=3 SV=1 43 592 7.0E-106
sp|A6Q182|ILVD_NITSB Dihydroxy-acid dehydratase OS=Nitratiruptor sp. (strain SB155-2) GN=ilvD PE=3 SV=1 43 592 1.0E-105
sp|C5BMB1|ILVD_TERTT Dihydroxy-acid dehydratase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ilvD PE=3 SV=1 30 574 4.0E-105
sp|A7GVT2|ILVD_CAMC5 Dihydroxy-acid dehydratase OS=Campylobacter curvus (strain 525.92) GN=ilvD PE=3 SV=1 43 595 8.0E-105
sp|Q8TW40|ILVD_METKA Dihydroxy-acid dehydratase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ilvD PE=3 SV=1 43 592 2.0E-104
sp|A7I439|ILVD_CAMHC Dihydroxy-acid dehydratase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=ilvD PE=3 SV=1 43 595 2.0E-103
sp|A7HIA1|ILVD_ANADF Dihydroxy-acid dehydratase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ilvD PE=3 SV=1 61 592 2.0E-102
sp|Q98BZ8|ILVD1_RHILO Dihydroxy-acid dehydratase 1 OS=Rhizobium loti (strain MAFF303099) GN=ilvD1 PE=3 SV=1 30 596 1.0E-101
sp|A0KQS4|ILVD_AERHH Dihydroxy-acid dehydratase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ilvD PE=3 SV=2 30 594 2.0E-101
sp|A4SHE9|ILVD_AERS4 Dihydroxy-acid dehydratase OS=Aeromonas salmonicida (strain A449) GN=ilvD PE=3 SV=1 30 594 2.0E-101
sp|B3PIW6|ILVD_CELJU Dihydroxy-acid dehydratase OS=Cellvibrio japonicus (strain Ueda107) GN=ilvD PE=3 SV=1 30 594 4.0E-101
sp|Q1GTW7|ILVD_SPHAL Dihydroxy-acid dehydratase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=ilvD PE=3 SV=1 30 594 3.0E-100
sp|Q6G543|ILVD_BARHE Dihydroxy-acid dehydratase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ilvD PE=3 SV=1 34 594 7.0E-100
sp|Q0BQR6|ILVD_GRABC Dihydroxy-acid dehydratase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ilvD PE=3 SV=1 30 594 7.0E-100
sp|B4SMU1|ILVD_STRM5 Dihydroxy-acid dehydratase OS=Stenotrophomonas maltophilia (strain R551-3) GN=ilvD PE=3 SV=1 38 592 1.0E-99
sp|Q92M28|ILVD_RHIME Dihydroxy-acid dehydratase OS=Rhizobium meliloti (strain 1021) GN=ilvD PE=3 SV=1 30 594 2.0E-99
sp|Q9I6E0|ILVD_PSEAE Dihydroxy-acid dehydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ilvD PE=3 SV=1 30 592 4.0E-99
sp|Q02U62|ILVD_PSEAB Dihydroxy-acid dehydratase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ilvD PE=3 SV=1 30 592 4.0E-99
sp|B7V2R6|ILVD_PSEA8 Dihydroxy-acid dehydratase OS=Pseudomonas aeruginosa (strain LESB58) GN=ilvD PE=3 SV=1 30 592 4.0E-99
sp|Q2NQA6|ILVD_SODGM Dihydroxy-acid dehydratase OS=Sodalis glossinidius (strain morsitans) GN=ilvD PE=3 SV=1 30 594 6.0E-99
sp|A4JN03|ILVD_BURVG Dihydroxy-acid dehydratase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ilvD PE=3 SV=1 30 594 6.0E-99
sp|Q46YI9|ILVD2_CUPPJ Dihydroxy-acid dehydratase 2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ilvD2 PE=3 SV=1 30 594 6.0E-99
sp|C5BBA5|ILVD_EDWI9 Dihydroxy-acid dehydratase OS=Edwardsiella ictaluri (strain 93-146) GN=ilvD PE=3 SV=1 30 594 7.0E-99
sp|Q394V3|ILVD1_BURL3 Dihydroxy-acid dehydratase 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ilvD1 PE=3 SV=1 30 594 1.0E-98
sp|Q21NV7|ILVD_SACD2 Dihydroxy-acid dehydratase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ilvD PE=3 SV=1 30 594 1.0E-98
sp|Q1IGF7|ILVD_PSEE4 Dihydroxy-acid dehydratase OS=Pseudomonas entomophila (strain L48) GN=ilvD PE=3 SV=1 30 592 2.0E-98
sp|Q9PH47|ILVD_XYLFA Dihydroxy-acid dehydratase OS=Xylella fastidiosa (strain 9a5c) GN=ilvD PE=3 SV=1 30 592 3.0E-98
sp|A4VRN4|ILVD_PSEU5 Dihydroxy-acid dehydratase OS=Pseudomonas stutzeri (strain A1501) GN=ilvD PE=3 SV=1 30 594 3.0E-98
sp|C3MIR3|ILVD_RHISN Dihydroxy-acid dehydratase OS=Rhizobium sp. (strain NGR234) GN=ilvD PE=3 SV=1 30 594 4.0E-98
sp|A1TMA7|ILVD_ACIAC Dihydroxy-acid dehydratase OS=Acidovorax citrulli (strain AAC00-1) GN=ilvD PE=3 SV=1 30 594 4.0E-98
sp|A6UD23|ILVD_SINMW Dihydroxy-acid dehydratase OS=Sinorhizobium medicae (strain WSM419) GN=ilvD PE=3 SV=1 30 594 8.0E-98
sp|Q87V83|ILVD_PSESM Dihydroxy-acid dehydratase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ilvD PE=3 SV=1 30 594 1.0E-97
sp|C3K3P0|ILVD_PSEFS Dihydroxy-acid dehydratase OS=Pseudomonas fluorescens (strain SBW25) GN=ilvD PE=3 SV=1 30 592 1.0E-97
sp|Q88CQ2|ILVD_PSEPK Dihydroxy-acid dehydratase OS=Pseudomonas putida (strain KT2440) GN=ilvD PE=3 SV=1 30 592 1.0E-97
sp|Q2K9I7|ILVD_RHIEC Dihydroxy-acid dehydratase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ilvD PE=3 SV=1 30 594 2.0E-97
sp|Q4K498|ILVD_PSEF5 Dihydroxy-acid dehydratase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ilvD PE=3 SV=1 30 592 2.0E-97
sp|B0KN82|ILVD_PSEPG Dihydroxy-acid dehydratase OS=Pseudomonas putida (strain GB-1) GN=ilvD PE=3 SV=1 30 592 2.0E-97
sp|A1K344|ILVD_AZOSB Dihydroxy-acid dehydratase OS=Azoarcus sp. (strain BH72) GN=ilvD PE=3 SV=1 30 594 2.0E-97
sp|B9JDW2|ILVD_AGRRK Dihydroxy-acid dehydratase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ilvD PE=3 SV=1 30 594 2.0E-97
sp|Q3K559|ILVD_PSEPF Dihydroxy-acid dehydratase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ilvD PE=3 SV=1 30 592 3.0E-97
sp|A6UYF6|ILVD_PSEA7 Dihydroxy-acid dehydratase OS=Pseudomonas aeruginosa (strain PA7) GN=ilvD PE=3 SV=1 30 594 3.0E-97
sp|B2IJH6|ILVD_BEII9 Dihydroxy-acid dehydratase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=ilvD PE=3 SV=1 30 594 3.0E-97
sp|Q48PA6|ILVD_PSE14 Dihydroxy-acid dehydratase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ilvD PE=3 SV=1 30 594 3.0E-97
sp|Q0HNC3|ILVD_SHESM Dihydroxy-acid dehydratase OS=Shewanella sp. (strain MR-4) GN=ilvD PE=3 SV=1 30 594 3.0E-97
sp|A1B673|ILVD_PARDP Dihydroxy-acid dehydratase OS=Paracoccus denitrificans (strain Pd 1222) GN=ilvD PE=3 SV=1 30 596 3.0E-97
sp|B3PWV1|ILVD_RHIE6 Dihydroxy-acid dehydratase OS=Rhizobium etli (strain CIAT 652) GN=ilvD PE=3 SV=1 30 594 3.0E-97
sp|B1J2M0|ILVD_PSEPW Dihydroxy-acid dehydratase OS=Pseudomonas putida (strain W619) GN=ilvD PE=3 SV=1 30 592 3.0E-97
sp|Q0HQG3|ILVD_SHESR Dihydroxy-acid dehydratase OS=Shewanella sp. (strain MR-7) GN=ilvD PE=3 SV=1 30 594 4.0E-97
sp|B7GUP9|ILVD_BIFLS Dihydroxy-acid dehydratase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=ilvD PE=3 SV=1 39 594 4.0E-97
sp|Q1MIB2|ILVD_RHIL3 Dihydroxy-acid dehydratase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ilvD PE=3 SV=1 30 594 5.0E-97
sp|A5WAG2|ILVD_PSEP1 Dihydroxy-acid dehydratase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ilvD PE=3 SV=1 30 592 7.0E-97
sp|A0KS32|ILVD_SHESA Dihydroxy-acid dehydratase OS=Shewanella sp. (strain ANA-3) GN=ilvD PE=3 SV=1 30 594 7.0E-97
sp|Q47JC0|ILVD_DECAR Dihydroxy-acid dehydratase OS=Dechloromonas aromatica (strain RCB) GN=ilvD PE=3 SV=1 30 594 7.0E-97
sp|Q2ISQ1|ILVD_RHOP2 Dihydroxy-acid dehydratase OS=Rhodopseudomonas palustris (strain HaA2) GN=ilvD PE=3 SV=1 30 594 1.0E-96
sp|Q4ZZ83|ILVD_PSEU2 Dihydroxy-acid dehydratase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ilvD PE=3 SV=1 30 594 2.0E-96
sp|B5ZZ62|ILVD_RHILW Dihydroxy-acid dehydratase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ilvD PE=3 SV=1 30 594 2.0E-96
sp|Q2G7E9|ILVD_NOVAD Dihydroxy-acid dehydratase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=ilvD PE=3 SV=1 30 594 2.0E-96
sp|B9JWU3|ILVD_AGRVS Dihydroxy-acid dehydratase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ilvD PE=3 SV=1 30 596 2.0E-96
sp|Q87F63|ILVD_XYLFT Dihydroxy-acid dehydratase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ilvD PE=3 SV=1 30 592 3.0E-96
sp|B2I699|ILVD_XYLF2 Dihydroxy-acid dehydratase OS=Xylella fastidiosa (strain M23) GN=ilvD PE=3 SV=1 30 592 3.0E-96
sp|A4Y036|ILVD_PSEMY Dihydroxy-acid dehydratase OS=Pseudomonas mendocina (strain ymp) GN=ilvD PE=3 SV=1 30 594 3.0E-96
sp|P55186|ILVD_CAUCR Dihydroxy-acid dehydratase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ilvD PE=2 SV=2 30 594 4.0E-96
sp|B8H367|ILVD_CAUCN Dihydroxy-acid dehydratase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ilvD PE=3 SV=1 30 594 4.0E-96
sp|B0U281|ILVD_XYLFM Dihydroxy-acid dehydratase OS=Xylella fastidiosa (strain M12) GN=ilvD PE=3 SV=1 30 592 5.0E-96
sp|Q4FS54|ILVD_PSYA2 Dihydroxy-acid dehydratase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ilvD PE=3 SV=1 38 594 6.0E-96
sp|Q8G3H2|ILVD_BIFLO Dihydroxy-acid dehydratase OS=Bifidobacterium longum (strain NCC 2705) GN=ilvD PE=3 SV=1 39 594 7.0E-96
sp|Q3J9N3|ILVD_NITOC Dihydroxy-acid dehydratase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ilvD PE=3 SV=1 30 594 9.0E-96
sp|C1DI94|ILVD_AZOVD Dihydroxy-acid dehydratase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ilvD PE=3 SV=1 30 592 1.0E-95
sp|B7NF78|ILVD_ECOLU Dihydroxy-acid dehydratase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ilvD PE=3 SV=1 30 594 1.0E-95
sp|A1A0T7|ILVD_BIFAA Dihydroxy-acid dehydratase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=ilvD PE=3 SV=1 30 594 1.0E-95
sp|B0RMB4|ILVD_XANCB Dihydroxy-acid dehydratase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ilvD PE=3 SV=1 30 594 1.0E-95
sp|B3Q6A0|ILVD_RHOPT Dihydroxy-acid dehydratase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ilvD PE=3 SV=1 30 594 1.0E-95
sp|B1IWX5|ILVD_ECOLC Dihydroxy-acid dehydratase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ilvD PE=3 SV=1 30 594 1.0E-95
sp|A8A6M7|ILVD_ECOHS Dihydroxy-acid dehydratase OS=Escherichia coli O9:H4 (strain HS) GN=ilvD PE=3 SV=1 30 594 1.0E-95
sp|A1SRU7|ILVD_PSYIN Dihydroxy-acid dehydratase OS=Psychromonas ingrahamii (strain 37) GN=ilvD PE=3 SV=1 30 594 1.0E-95
sp|Q6N9S5|ILVD_RHOPA Dihydroxy-acid dehydratase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ilvD PE=3 SV=1 30 594 1.0E-95
sp|Q83PI6|ILVD_SHIFL Dihydroxy-acid dehydratase OS=Shigella flexneri GN=ilvD PE=3 SV=1 30 594 2.0E-95
sp|B4SZ17|ILVD_SALNS Dihydroxy-acid dehydratase OS=Salmonella newport (strain SL254) GN=ilvD PE=3 SV=1 30 594 3.0E-95
sp|B1LLU6|ILVD_ECOSM Dihydroxy-acid dehydratase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ilvD PE=3 SV=1 30 594 3.0E-95
sp|A0RRN7|ILVD_CAMFF Dihydroxy-acid dehydratase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=ilvD PE=3 SV=1 43 595 3.0E-95
sp|Q3YVJ3|ILVD_SHISS Dihydroxy-acid dehydratase OS=Shigella sonnei (strain Ss046) GN=ilvD PE=3 SV=1 30 594 3.0E-95
sp|P40810|ILVD_SALTY Dihydroxy-acid dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvD PE=3 SV=2 30 594 4.0E-95
sp|B5EZ28|ILVD_SALA4 Dihydroxy-acid dehydratase OS=Salmonella agona (strain SL483) GN=ilvD PE=3 SV=1 30 594 4.0E-95
sp|B4TB04|ILVD_SALHS Dihydroxy-acid dehydratase OS=Salmonella heidelberg (strain SL476) GN=ilvD PE=3 SV=1 30 594 4.0E-95
sp|A9MXE2|ILVD_SALPB Dihydroxy-acid dehydratase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ilvD PE=3 SV=1 30 594 4.0E-95
sp|A6TGF8|ILVD_KLEP7 Dihydroxy-acid dehydratase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ilvD PE=3 SV=1 30 594 4.0E-95
sp|Q0SYW3|ILVD_SHIF8 Dihydroxy-acid dehydratase OS=Shigella flexneri serotype 5b (strain 8401) GN=ilvD PE=3 SV=1 30 594 5.0E-95
sp|B6I4A8|ILVD_ECOSE Dihydroxy-acid dehydratase OS=Escherichia coli (strain SE11) GN=ilvD PE=3 SV=1 30 594 5.0E-95
sp|B7M5B9|ILVD_ECO8A Dihydroxy-acid dehydratase OS=Escherichia coli O8 (strain IAI1) GN=ilvD PE=3 SV=1 30 594 5.0E-95
sp|A7ZTX3|ILVD_ECO24 Dihydroxy-acid dehydratase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ilvD PE=3 SV=1 30 594 5.0E-95
sp|Q5N3N2|ILVD_SYNP6 Dihydroxy-acid dehydratase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ilvD PE=3 SV=1 30 594 5.0E-95
sp|Q31QL1|ILVD_SYNE7 Dihydroxy-acid dehydratase OS=Synechococcus elongatus (strain PCC 7942) GN=ilvD PE=3 SV=1 30 594 5.0E-95
sp|B7L8B3|ILVD_ECO55 Dihydroxy-acid dehydratase OS=Escherichia coli (strain 55989 / EAEC) GN=ilvD PE=3 SV=1 30 594 5.0E-95
sp|Q5P6F1|ILVD2_AROAE Dihydroxy-acid dehydratase 2 OS=Aromatoleum aromaticum (strain EbN1) GN=ilvD2 PE=3 SV=1 38 594 5.0E-95
sp|B5RFT3|ILVD_SALG2 Dihydroxy-acid dehydratase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ilvD PE=3 SV=1 30 594 6.0E-95
sp|Q8PDJ3|ILVD_XANCP Dihydroxy-acid dehydratase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ilvD PE=3 SV=1 30 594 6.0E-95
sp|Q4UZT2|ILVD_XANC8 Dihydroxy-acid dehydratase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ilvD PE=3 SV=1 30 594 6.0E-95
sp|B2FMH4|ILVD_STRMK Dihydroxy-acid dehydratase OS=Stenotrophomonas maltophilia (strain K279a) GN=ilvD PE=3 SV=1 38 592 6.0E-95
sp|C0Q2U8|ILVD_SALPC Dihydroxy-acid dehydratase OS=Salmonella paratyphi C (strain RKS4594) GN=ilvD PE=3 SV=1 30 594 6.0E-95
sp|Q57HU7|ILVD_SALCH Dihydroxy-acid dehydratase OS=Salmonella choleraesuis (strain SC-B67) GN=ilvD PE=3 SV=1 30 594 6.0E-95
sp|A8IES7|ILVD_AZOC5 Dihydroxy-acid dehydratase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=ilvD PE=3 SV=1 30 594 7.0E-95
sp|Q0TAU9|ILVD_ECOL5 Dihydroxy-acid dehydratase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ilvD PE=3 SV=1 30 594 8.0E-95
sp|B7N266|ILVD_ECO81 Dihydroxy-acid dehydratase OS=Escherichia coli O81 (strain ED1a) GN=ilvD PE=3 SV=1 30 594 8.0E-95
sp|Q3IXP4|ILVD_RHOS4 Dihydroxy-acid dehydratase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ilvD PE=3 SV=1 30 596 8.0E-95
sp|A3PRB5|ILVD_RHOS1 Dihydroxy-acid dehydratase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ilvD PE=3 SV=1 30 596 8.0E-95
sp|B7NU26|ILVD_ECO7I Dihydroxy-acid dehydratase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ilvD PE=3 SV=1 30 594 9.0E-95
sp|B7LU82|ILVD_ESCF3 Dihydroxy-acid dehydratase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ilvD PE=3 SV=1 30 594 9.0E-95
sp|B5QVG2|ILVD_SALEP Dihydroxy-acid dehydratase OS=Salmonella enteritidis PT4 (strain P125109) GN=ilvD PE=3 SV=1 30 594 9.0E-95
sp|B5FN65|ILVD_SALDC Dihydroxy-acid dehydratase OS=Salmonella dublin (strain CT_02021853) GN=ilvD PE=3 SV=1 30 594 9.0E-95
sp|Q1R4G6|ILVD_ECOUT Dihydroxy-acid dehydratase OS=Escherichia coli (strain UTI89 / UPEC) GN=ilvD PE=3 SV=1 30 594 1.0E-94
sp|A1AHU3|ILVD_ECOK1 Dihydroxy-acid dehydratase OS=Escherichia coli O1:K1 / APEC GN=ilvD PE=3 SV=1 30 594 1.0E-94
sp|B5YY20|ILVD_ECO5E Dihydroxy-acid dehydratase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ilvD PE=3 SV=1 30 594 1.0E-94
sp|Q8XAV1|ILVD_ECO57 Dihydroxy-acid dehydratase OS=Escherichia coli O157:H7 GN=ilvD PE=3 SV=3 30 594 1.0E-94
sp|B5BIR7|ILVD_SALPK Dihydroxy-acid dehydratase OS=Salmonella paratyphi A (strain AKU_12601) GN=ilvD PE=3 SV=1 30 594 1.0E-94
sp|Q5PK00|ILVD_SALPA Dihydroxy-acid dehydratase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ilvD PE=3 SV=1 30 594 1.0E-94
sp|B8EQC8|ILVD_METSB Dihydroxy-acid dehydratase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ilvD PE=3 SV=1 30 567 1.0E-94
sp|P05791|ILVD_ECOLI Dihydroxy-acid dehydratase OS=Escherichia coli (strain K12) GN=ilvD PE=1 SV=5 30 594 1.0E-94
sp|C4ZZ41|ILVD_ECOBW Dihydroxy-acid dehydratase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ilvD PE=3 SV=1 30 594 1.0E-94
sp|Q6FCR9|ILVD1_ACIAD Dihydroxy-acid dehydratase 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ilvD1 PE=3 SV=1 30 592 1.0E-94
sp|Q31UL3|ILVD_SHIBS Dihydroxy-acid dehydratase OS=Shigella boydii serotype 4 (strain Sb227) GN=ilvD PE=3 SV=1 30 594 1.0E-94
sp|B2TU20|ILVD_SHIB3 Dihydroxy-acid dehydratase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ilvD PE=3 SV=1 30 594 1.0E-94
sp|Q8E9D9|ILVD_SHEON Dihydroxy-acid dehydratase OS=Shewanella oneidensis (strain MR-1) GN=ilvD PE=3 SV=1 30 594 1.0E-94
sp|B2I2H6|ILVD_ACIBC Dihydroxy-acid dehydratase OS=Acinetobacter baumannii (strain ACICU) GN=ilvD PE=3 SV=1 30 592 1.0E-94
sp|A6LDP0|ILVD_PARD8 Dihydroxy-acid dehydratase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ilvD PE=3 SV=1 39 592 1.0E-94
sp|B4TNS1|ILVD_SALSV Dihydroxy-acid dehydratase OS=Salmonella schwarzengrund (strain CVM19633) GN=ilvD PE=3 SV=1 30 594 2.0E-94
sp|B8F506|ILVD_HAEPS Dihydroxy-acid dehydratase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=ilvD PE=3 SV=1 30 594 2.0E-94
sp|Q8Z377|ILVD_SALTI Dihydroxy-acid dehydratase OS=Salmonella typhi GN=ilvD PE=3 SV=1 30 594 2.0E-94
sp|B7MGI3|ILVD_ECO45 Dihydroxy-acid dehydratase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ilvD PE=3 SV=1 34 594 2.0E-94
sp|A5UDY7|ILVD_HAEIE Dihydroxy-acid dehydratase OS=Haemophilus influenzae (strain PittEE) GN=ilvD PE=3 SV=1 30 594 2.0E-94
sp|A1SAS5|ILVD_SHEAM Dihydroxy-acid dehydratase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ilvD PE=3 SV=1 30 594 2.0E-94
sp|C6DHH1|ILVD_PECCP Dihydroxy-acid dehydratase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ilvD PE=3 SV=1 30 594 3.0E-94
sp|A4YBI7|ILVD_SHEPC Dihydroxy-acid dehydratase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ilvD PE=3 SV=1 30 594 3.0E-94
sp|A3Q9L6|ILVD_SHELP Dihydroxy-acid dehydratase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ilvD PE=3 SV=1 30 594 3.0E-94
sp|B5XZ01|ILVD_KLEP3 Dihydroxy-acid dehydratase OS=Klebsiella pneumoniae (strain 342) GN=ilvD PE=3 SV=1 30 594 3.0E-94
sp|A9ILS3|ILVD_BART1 Dihydroxy-acid dehydratase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ilvD PE=3 SV=1 34 594 3.0E-94
sp|Q8DDG1|ILVD_VIBVU Dihydroxy-acid dehydratase OS=Vibrio vulnificus (strain CMCP6) GN=ilvD PE=3 SV=1 30 594 3.0E-94
sp|Q31I28|ILVD_THICR Dihydroxy-acid dehydratase OS=Thiomicrospira crunogena (strain XCL-2) GN=ilvD PE=3 SV=1 30 592 4.0E-94
sp|Q4QMF8|ILVD_HAEI8 Dihydroxy-acid dehydratase OS=Haemophilus influenzae (strain 86-028NP) GN=ilvD PE=3 SV=1 30 594 5.0E-94
sp|B0VQ11|ILVD_ACIBS Dihydroxy-acid dehydratase OS=Acinetobacter baumannii (strain SDF) GN=ilvD PE=3 SV=1 30 592 5.0E-94
sp|B7I2C2|ILVD_ACIB5 Dihydroxy-acid dehydratase OS=Acinetobacter baumannii (strain AB0057) GN=ilvD PE=3 SV=1 30 592 5.0E-94
sp|A3MAA0|ILVD_ACIBT Dihydroxy-acid dehydratase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=ilvD PE=3 SV=2 30 592 6.0E-94
sp|A8GL60|ILVD_SERP5 Dihydroxy-acid dehydratase OS=Serratia proteamaculans (strain 568) GN=ilvD PE=3 SV=1 30 594 6.0E-94
sp|Q8FBR5|ILVD_ECOL6 Dihydroxy-acid dehydratase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ilvD PE=3 SV=3 30 594 7.0E-94
sp|Q329V0|ILVD_SHIDS Dihydroxy-acid dehydratase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ilvD PE=3 SV=1 30 594 7.0E-94
sp|A1RPG2|ILVD_SHESW Dihydroxy-acid dehydratase OS=Shewanella sp. (strain W3-18-1) GN=ilvD PE=3 SV=1 30 594 8.0E-94
sp|B0VAE1|ILVD_ACIBY Dihydroxy-acid dehydratase OS=Acinetobacter baumannii (strain AYE) GN=ilvD PE=3 SV=1 30 592 9.0E-94
sp|B7GUZ8|ILVD_ACIB3 Dihydroxy-acid dehydratase OS=Acinetobacter baumannii (strain AB307-0294) GN=ilvD PE=3 SV=1 30 592 9.0E-94
sp|Q8UE43|ILVD_AGRFC Dihydroxy-acid dehydratase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ilvD PE=3 SV=2 30 596 1.0E-93
sp|Q6CZC7|ILVD_PECAS Dihydroxy-acid dehydratase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ilvD PE=3 SV=1 30 594 1.0E-93
sp|A4WG37|ILVD_ENT38 Dihydroxy-acid dehydratase OS=Enterobacter sp. (strain 638) GN=ilvD PE=3 SV=1 30 594 1.0E-93
sp|Q07IE7|ILVD_RHOP5 Dihydroxy-acid dehydratase OS=Rhodopseudomonas palustris (strain BisA53) GN=ilvD PE=3 SV=1 34 592 1.0E-93
sp|B4F1U3|ILVD_PROMH Dihydroxy-acid dehydratase OS=Proteus mirabilis (strain HI4320) GN=ilvD PE=3 SV=1 30 594 1.0E-93
sp|P44851|ILVD_HAEIN Dihydroxy-acid dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvD PE=3 SV=1 30 594 1.0E-93
sp|B7UMM8|ILVD_ECO27 Dihydroxy-acid dehydratase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ilvD PE=3 SV=1 30 594 1.0E-93
sp|B8E8A9|ILVD_SHEB2 Dihydroxy-acid dehydratase OS=Shewanella baltica (strain OS223) GN=ilvD PE=3 SV=1 30 594 1.0E-93
sp|A5UHP2|ILVD_HAEIG Dihydroxy-acid dehydratase OS=Haemophilus influenzae (strain PittGG) GN=ilvD PE=3 SV=1 30 594 1.0E-93
sp|Q15MY9|ILVD_PSEA6 Dihydroxy-acid dehydratase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=ilvD PE=3 SV=1 30 567 1.0E-93
sp|A3D9T2|ILVD_SHEB5 Dihydroxy-acid dehydratase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ilvD PE=3 SV=1 30 594 1.0E-93
sp|Q7MGI8|ILVD_VIBVY Dihydroxy-acid dehydratase OS=Vibrio vulnificus (strain YJ016) GN=ilvD PE=3 SV=1 30 594 2.0E-93
sp|A6WTI9|ILVD_SHEB8 Dihydroxy-acid dehydratase OS=Shewanella baltica (strain OS185) GN=ilvD PE=3 SV=1 30 594 2.0E-93
sp|Q47MS7|ILVD_THEFY Dihydroxy-acid dehydratase OS=Thermobifida fusca (strain YX) GN=ilvD PE=3 SV=1 30 563 2.0E-93
sp|Q3SW60|ILVD_NITWN Dihydroxy-acid dehydratase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ilvD PE=3 SV=1 30 592 3.0E-93
sp|Q3BYS5|ILVD_XANC5 Dihydroxy-acid dehydratase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ilvD PE=3 SV=1 30 594 3.0E-93
sp|C4LDS1|ILVD_TOLAT Dihydroxy-acid dehydratase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ilvD PE=3 SV=1 30 594 3.0E-93
sp|B2VI72|ILVD_ERWT9 Dihydroxy-acid dehydratase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ilvD PE=3 SV=1 30 594 3.0E-93
sp|A9L621|ILVD_SHEB9 Dihydroxy-acid dehydratase OS=Shewanella baltica (strain OS195) GN=ilvD PE=3 SV=1 30 594 4.0E-93
sp|Q5GUY8|ILVD_XANOR Dihydroxy-acid dehydratase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ilvD PE=3 SV=1 30 594 4.0E-93
sp|B2SK80|ILVD_XANOP Dihydroxy-acid dehydratase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ilvD PE=3 SV=1 30 594 4.0E-93
sp|Q2NY76|ILVD_XANOM Dihydroxy-acid dehydratase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ilvD PE=3 SV=1 30 594 4.0E-93
sp|A6WV39|ILVD_OCHA4 Dihydroxy-acid dehydratase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ilvD PE=3 SV=1 30 596 6.0E-93
sp|A7IBD6|ILVD_XANP2 Dihydroxy-acid dehydratase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=ilvD PE=3 SV=1 30 594 1.0E-92
sp|Q5FN26|ILVD_GLUOX Dihydroxy-acid dehydratase OS=Gluconobacter oxydans (strain 621H) GN=ilvD PE=3 SV=1 30 594 1.0E-92
sp|Q9RV97|ILVD_DEIRA Dihydroxy-acid dehydratase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ilvD PE=3 SV=1 30 592 2.0E-92
sp|Q7W069|ILVD1_BORPE Dihydroxy-acid dehydratase 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ilvD1 PE=3 SV=1 30 594 2.0E-92
sp|A8GZD9|ILVD_SHEPA Dihydroxy-acid dehydratase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ilvD PE=3 SV=1 30 594 2.0E-92
sp|Q5LN98|ILVD_RUEPO Dihydroxy-acid dehydratase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ilvD PE=3 SV=1 30 592 2.0E-92
sp|P57957|ILVD_PASMU Dihydroxy-acid dehydratase OS=Pasteurella multocida (strain Pm70) GN=ilvD PE=3 SV=1 30 594 3.0E-92
sp|C3LPA1|ILVD_VIBCM Dihydroxy-acid dehydratase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ilvD PE=3 SV=1 30 594 3.0E-92
sp|Q9KVW0|ILVD_VIBCH Dihydroxy-acid dehydratase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ilvD PE=3 SV=1 30 594 3.0E-92
sp|A5F497|ILVD_VIBC3 Dihydroxy-acid dehydratase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ilvD PE=3 SV=1 30 594 3.0E-92
sp|Q0C2B5|ILVD_HYPNA Dihydroxy-acid dehydratase OS=Hyphomonas neptunium (strain ATCC 15444) GN=ilvD PE=3 SV=1 30 592 4.0E-92
sp|A5VN43|ILVD_BRUO2 Dihydroxy-acid dehydratase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ilvD PE=3 SV=2 30 574 4.0E-92
sp|C0RGF9|ILVD_BRUMB Dihydroxy-acid dehydratase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ilvD PE=3 SV=1 30 574 4.0E-92
sp|Q57FS2|ILVD_BRUAB Dihydroxy-acid dehydratase OS=Brucella abortus biovar 1 (strain 9-941) GN=ilvD PE=3 SV=1 30 574 4.0E-92
sp|Q2YNW9|ILVD_BRUA2 Dihydroxy-acid dehydratase OS=Brucella abortus (strain 2308) GN=ilvD PE=3 SV=1 30 574 4.0E-92
sp|B2S7Z5|ILVD_BRUA1 Dihydroxy-acid dehydratase OS=Brucella abortus (strain S19) GN=ilvD PE=3 SV=1 30 574 4.0E-92
sp|Q2W485|ILVD_MAGSA Dihydroxy-acid dehydratase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=ilvD PE=3 SV=1 30 594 4.0E-92
sp|B1KQ88|ILVD_SHEWM Dihydroxy-acid dehydratase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ilvD PE=3 SV=1 30 567 4.0E-92
sp|B0TJR3|ILVD_SHEHH Dihydroxy-acid dehydratase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ilvD PE=3 SV=1 30 594 4.0E-92
sp|Q7NYJ7|ILVD_CHRVO Dihydroxy-acid dehydratase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ilvD PE=3 SV=1 30 594 5.0E-92
sp|B0CIL1|ILVD_BRUSI Dihydroxy-acid dehydratase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ilvD PE=3 SV=1 30 574 7.0E-92
sp|Q8PQI0|ILVD_XANAC Dihydroxy-acid dehydratase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ilvD PE=3 SV=1 30 594 7.0E-92
sp|Q8G353|ILVD_BRUSU Dihydroxy-acid dehydratase OS=Brucella suis biovar 1 (strain 1330) GN=ilvD PE=3 SV=1 30 574 1.0E-91
sp|A9M6V2|ILVD_BRUC2 Dihydroxy-acid dehydratase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ilvD PE=3 SV=1 30 574 1.0E-91
[Show less]

GO

GO Term Description Terminal node
GO:0016836 hydro-lyase activity Yes
GO:0003674 molecular_function No
GO:0016835 carbon-oxygen lyase activity No
GO:0003824 catalytic activity No
GO:0016829 lyase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup160
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5846
Ophiocordyceps australis 1348a (Ghana) OphauG2|902 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6233
Ophiocordyceps australis map64 (Brazil) OphauB2|8136
Ophiocordyceps camponoti-floridani Ophcf2|01694
Ophiocordyceps camponoti-floridani Ophcf2|03058
Ophiocordyceps camponoti-rufipedis Ophun1|526
Ophiocordyceps camponoti-rufipedis Ophun1|6654
Ophiocordyceps kimflemingae Ophio5|6483
Ophiocordyceps kimflemingae Ophio5|6937
Ophiocordyceps subramaniannii Hirsu2|11257
Ophiocordyceps subramaniannii Hirsu2|3061

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|902
MAVPGPDPKATPDLVRFDCLPPGGKLNRWSTNLTRRHDLPGSRAMLYGAGVPSPEAMESAPHVGIATVWWEGNPT
HLLDLGAIVKRSVEKHGMLGWQFNTVGVSDAITMGGDGMRFSLQTRELIADSIESVTMAQHHDANVAIPGCDKNM
PGVVMAAARHNRPFIMIYGGTIRKGYSKLLARHVNVTTCFEAAGAHVYGRLKAAEGVDGQYSSEDVLDDVERSAC
PGAGACGGMYTANTMATAIETMGLTLPGSSSFPAESPEKARECQRVGEAIATTMTLDIRPRDLLTRAAFENALVI
LIILGGSTNGVLHILAMANTAGVPLTLDDIARTSNRTPVLADLAPSGRFLMEDLYAIGGTPSVLKLLIAKRLIDG
SLPTVTGRSLAENVADWPSLDPGQEIIRPLDNPIKPTGHIRVLRGNLAPGGAVAKITGKEGLCFSGAARVYDCER
HLNAALSAGLIRPDDGNLVLVVRYEGPRGGPGMPEQLRASAAISGAGLTNVALITDGRYSGASHGFIVGHIVPEA
SQGGPIALLRDGDVITIDAERDRIDVAVADDEMQRRRDAWTPPEPRVKRGVLAKYARLVGDASHGAITDAP*
Coding >OphauG2|902
ATGGCAGTCCCCGGCCCAGACCCCAAGGCCACGCCAGACCTGGTCCGCTTCGACTGTCTGCCACCAGGCGGGAAG
CTCAACCGATGGTCCACCAACCTGACCCGCCGCCATGACCTGCCTGGATCTCGCGCCATGCTCTACGGTGCAGGC
GTGCCCAGCCCAGAGGCCATGGAGAGCGCTCCGCACGTGGGCATCGCGACGGTGTGGTGGGAGGGCAACCCCACC
CATCTTCTTGACCTTGGCGCCATTGTAAAGCGCTCTGTCGAGAAGCACGGCATGCTCGGCTGGCAGTTCAACACG
GTTGGCGTGTCGGATGCCATCACCATGGGCGGCGACGGCATGCGCTTCTCGCTGCAGACGCGCGAGCTCATTGCT
GACTCGATCGAGTCCGTCACCATGGCCCAGCACCACGACGCAAACGTGGCTATTCCTGGCTGCGACAAGAACATG
CCTGGCGTCGTCATGGCTGCTGCTCGCCACAATCGCCCCTTTATTATGATCTACGGCGGTACCATCCGCAAGGGC
TATTCCAAGCTCCTTGCCCGCCATGTCAACGTGACAACGTGCTTCGAAGCCGCTGGCGCCCACGTCTATGGCCGC
CTCAAGGCCGCCGAGGGAGTCGACGGACAGTATTCATCTGAAGACGTCCTCGATGATGTAGAGCGCAGCGCCTGT
CCAGGGGCTGGTGCCTGTGGCGGAATGTACACGGCCAACACCATGGCAACGGCCATAGAGACCATGGGCCTGACT
CTCCCCGGCTCATCTTCCTTCCCGGCCGAGTCGCCAGAAAAGGCGCGCGAGTGCCAACGCGTGGGCGAGGCTATT
GCCACCACTATGACGCTCGATATTCGCCCCCGCGATCTGCTGACACGCGCCGCTTTTGAAAACGCCCTTGTTATT
CTTATTATTCTAGGCGGCTCCACCAACGGCGTTCTTCATATTCTCGCCATGGCCAACACTGCTGGAGTGCCTCTG
ACCCTCGACGACATTGCCCGTACTAGCAACCGCACTCCCGTTCTGGCCGACCTCGCCCCCAGCGGCCGCTTTCTC
ATGGAGGATCTTTACGCCATTGGCGGCACTCCTTCGGTCCTCAAGCTGCTCATTGCCAAGCGCCTCATTGACGGC
TCGTTGCCCACAGTCACTGGCCGCTCCCTAGCGGAAAACGTTGCCGACTGGCCCAGCCTTGATCCCGGACAGGAA
ATCATTCGCCCCCTGGACAATCCCATCAAGCCCACAGGCCATATTCGCGTTTTGCGAGGCAACCTTGCCCCAGGC
GGCGCCGTGGCCAAAATCACTGGTAAAGAGGGCCTTTGTTTCTCTGGCGCCGCCCGCGTCTATGACTGTGAACGC
CATCTCAACGCTGCTCTGAGCGCCGGCCTGATTCGCCCCGACGACGGCAATCTCGTTCTCGTCGTCCGCTACGAG
GGCCCGAGAGGCGGCCCGGGCATGCCCGAGCAGTTGCGCGCCTCGGCTGCCATTTCGGGCGCCGGGCTCACCAAT
GTCGCCCTGATTACCGACGGGAGATATAGCGGTGCTTCTCATGGCTTTATTGTCGGCCACATTGTTCCCGAGGCG
TCTCAAGGCGGCCCCATTGCCCTCCTCCGCGACGGCGATGTCATCACCATTGACGCCGAGCGCGACCGCATCGAT
GTAGCTGTAGCCGATGATGAGATGCAGCGCCGTAGAGACGCGTGGACGCCCCCTGAGCCGCGGGTCAAGAGAGGT
GTCTTGGCAAAGTACGCCCGGCTCGTTGGCGATGCGAGCCACGGCGCCATTACCGACGCCCCTTGA
Transcript >OphauG2|902
ATGGCAGTCCCCGGCCCAGACCCCAAGGCCACGCCAGACCTGGTCCGCTTCGACTGTCTGCCACCAGGCGGGAAG
CTCAACCGATGGTCCACCAACCTGACCCGCCGCCATGACCTGCCTGGATCTCGCGCCATGCTCTACGGTGCAGGC
GTGCCCAGCCCAGAGGCCATGGAGAGCGCTCCGCACGTGGGCATCGCGACGGTGTGGTGGGAGGGCAACCCCACC
CATCTTCTTGACCTTGGCGCCATTGTAAAGCGCTCTGTCGAGAAGCACGGCATGCTCGGCTGGCAGTTCAACACG
GTTGGCGTGTCGGATGCCATCACCATGGGCGGCGACGGCATGCGCTTCTCGCTGCAGACGCGCGAGCTCATTGCT
GACTCGATCGAGTCCGTCACCATGGCCCAGCACCACGACGCAAACGTGGCTATTCCTGGCTGCGACAAGAACATG
CCTGGCGTCGTCATGGCTGCTGCTCGCCACAATCGCCCCTTTATTATGATCTACGGCGGTACCATCCGCAAGGGC
TATTCCAAGCTCCTTGCCCGCCATGTCAACGTGACAACGTGCTTCGAAGCCGCTGGCGCCCACGTCTATGGCCGC
CTCAAGGCCGCCGAGGGAGTCGACGGACAGTATTCATCTGAAGACGTCCTCGATGATGTAGAGCGCAGCGCCTGT
CCAGGGGCTGGTGCCTGTGGCGGAATGTACACGGCCAACACCATGGCAACGGCCATAGAGACCATGGGCCTGACT
CTCCCCGGCTCATCTTCCTTCCCGGCCGAGTCGCCAGAAAAGGCGCGCGAGTGCCAACGCGTGGGCGAGGCTATT
GCCACCACTATGACGCTCGATATTCGCCCCCGCGATCTGCTGACACGCGCCGCTTTTGAAAACGCCCTTGTTATT
CTTATTATTCTAGGCGGCTCCACCAACGGCGTTCTTCATATTCTCGCCATGGCCAACACTGCTGGAGTGCCTCTG
ACCCTCGACGACATTGCCCGTACTAGCAACCGCACTCCCGTTCTGGCCGACCTCGCCCCCAGCGGCCGCTTTCTC
ATGGAGGATCTTTACGCCATTGGCGGCACTCCTTCGGTCCTCAAGCTGCTCATTGCCAAGCGCCTCATTGACGGC
TCGTTGCCCACAGTCACTGGCCGCTCCCTAGCGGAAAACGTTGCCGACTGGCCCAGCCTTGATCCCGGACAGGAA
ATCATTCGCCCCCTGGACAATCCCATCAAGCCCACAGGCCATATTCGCGTTTTGCGAGGCAACCTTGCCCCAGGC
GGCGCCGTGGCCAAAATCACTGGTAAAGAGGGCCTTTGTTTCTCTGGCGCCGCCCGCGTCTATGACTGTGAACGC
CATCTCAACGCTGCTCTGAGCGCCGGCCTGATTCGCCCCGACGACGGCAATCTCGTTCTCGTCGTCCGCTACGAG
GGCCCGAGAGGCGGCCCGGGCATGCCCGAGCAGTTGCGCGCCTCGGCTGCCATTTCGGGCGCCGGGCTCACCAAT
GTCGCCCTGATTACCGACGGGAGATATAGCGGTGCTTCTCATGGCTTTATTGTCGGCCACATTGTTCCCGAGGCG
TCTCAAGGCGGCCCCATTGCCCTCCTCCGCGACGGCGATGTCATCACCATTGACGCCGAGCGCGACCGCATCGAT
GTAGCTGTAGCCGATGATGAGATGCAGCGCCGTAGAGACGCGTGGACGCCCCCTGAGCCGCGGGTCAAGAGAGGT
GTCTTGGCAAAGTACGCCCGGCTCGTTGGCGATGCGAGCCACGGCGCCATTACCGACGCCCCTTGA
Gene >OphauG2|902
ATGGCAGTCCCCGGCCCAGACCCCAAGGCCACGCCAGACCTGGTCCGCTTCGACTGTCTGCCACCAGGCGGGAAG
CTCAACCGATGGTCCACCAACCTGACCCGCCGCCATGACCTGCCTGGATCTCGCGTCAGCTGCCTCTGGTCCAGC
GCGGCTACTTGACAGGCTGACTTTGCCAGGCCATGCTCTACGGTGCAGGCGTGCCCAGCCCAGAGGCCATGGAGA
GCGCTCCGCACGTGGGCATCGCGACGGTGTGGTGGGAGGGCAACCCGTGCAAGCAAGTCTCTTTTTTTTCCCTTG
CCACAGCCCCAGCTATAGCCCAAGCCATAGATAGCCATGCTAACATGGACGCGCTCAATTTTTTATCTTTATTTT
CAAATTTAAAGCACCCATCGTGAGTCCTTTTTGCCGTCCCATTGCTCCCGCCGACTCTCGCCTACTCACGTGTCT
CGCCAGTTCTTGACCTTGGCGCCATTGTAAAGCGCTCTGTCGAGAAGCACGGCATGCTCGGCTGGCAGTTCAACA
CGGTTGGCGTGTCGGATGCCATCACCATGGGCGGCGACGGTGCGCTTACTGCTGCCCCCGTGTGCGCCCTCGGAG
CCCCTGGTTGACGGCTCTAGGCATGCGCTTCTCGCTGCAGACGCGCGAGCTCATTGCTGACTCGATCGAGTCCGT
CACCATGGCCCAGCACCACGACGCAAACGTGGCTATTCCTGGCTGCGACAAGAACATGCCTGGCGTCGTCATGGC
TGCTGCTCGCCACAATCGCCCCTTTATTATGATCTACGGCGGTACCATCCGCAAGGGCTATTCCAAGCTCCTTGC
CCGCCATGTCAACGTGACAACGTGCTTCGAAGCCGCTGGCGCCCACGTCTATGGCCGCCTCAAGGCCGCCGAGGG
AGTCGACGGACAGTATTCATCTGAAGACGTCCTCGATGATGTAGAGCGCAGCGCCTGTCCAGGGGCTGGTGCCTG
TGGCGGAATGTACACGGCCAACACCATGGCAACGGCCATAGAGACCATGGGCCTGACTCTCCCCGGCTCATCTTC
CTTCCCGGCCGAGTCGCCAGAAAAGGCGCGCGAGTGCCAACGCGTGGGCGAGGCTATTGCCACCACTATGACGCT
CGATATTCGCCCCCGCGATCTGCTGACACGCGCCGCTTTTGAAAACGCCCTTGTTATTCTTATTATTCTAGGCGG
CTCCACCAACGGCGTTCTTCATATTCTCGCCATGGCCAACACTGCTGGAGTGCCTCTGACCCTCGACGACATTGC
CCGTACTAGCAACCGCACTCCCGTTCTGGCCGACCTCGCCCCCAGCGGCCGCTTTCTCATGGAGGATCTTTACGC
CATTGGCGGCACTCCTTCGGTCCTCAAGCTGCTCATTGCCAAGCGCCTCATTGACGGCTCGTTGCCCACAGTCAC
TGGCCGCTCCCTAGCGGAAAACGTTGCCGACTGGCCCAGCCTTGATCCCGGACAGGAAATCATTCGCCCCCTGGA
CAATCCCATCAAGCCCACAGGCCATATTCGCGTTTTGCGAGGCAACCTTGCCCCAGGCGGCGCCGTGGCCAAAAT
CACTGGTAAAGAGGGCCTTTGTTTCTCTGGCGCCGCCCGCGTCTATGACTGTGAACGCCATCTCAACGCTGCTCT
GAGCGCCGGCCTGATTCGCCCCGACGACGGCAATCTCGTTCTCGTCGTCCGCTACGAGGGCCCGAGAGGCGGCCC
GGGCATGCCCGAGCAGTTGCGCGCCTCGGCTGCCATTTCGGGCGCCGGGCTCACCAATGTCGCCCTGATTACCGA
CGGGAGATATAGCGGTGCTTCTCATGGCTTTATTGTCGGCCACATTGTTCCCGAGGCGTCTCAAGGCGGCCCCAT
TGCCCTCCTCCGCGACGGCGATGTCATCACCATTGACGCCGAGCGCGACCGCATCGATGTAGCTGTAGCCGATGA
TGAGATGCAGCGCCGTAGAGACGCGTGGACGCCCCCTGAGCCGCGGGTCAAGAGAGGTGTCTTGGCAAAGTACGC
CCGGCTCGTTGGCGATGCGAGCCACGGCGCCATTACCGACGCCCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail