Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|9
Gene name
LocationContig_1:15749..16747
Strand+
Gene length (bp)998
Transcript length (bp)885
Coding sequence length (bp)885
Protein length (aa) 295

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00318 Ribosomal_S2 Ribosomal protein S2 2.8E-08 21 116
PF00318 Ribosomal_S2 Ribosomal protein S2 7.0E-14 120 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4R188|RSSA_MAGO7 40S ribosomal protein S0 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RPS0 PE=3 SV=1 4 294 5.0E-164
sp|C7Z0Q8|RSSA_NECH7 40S ribosomal protein S0 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RPS0 PE=3 SV=1 4 278 8.0E-161
sp|A7F2R3|RSSA_SCLS1 40S ribosomal protein S0 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rps0 PE=3 SV=1 4 294 3.0E-150
sp|B2B1Z3|RSSA_PODAN 40S ribosomal protein S0 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=RPS0 PE=3 SV=1 4 294 1.0E-149
sp|Q01291|RSSA_NEUCR 40S ribosomal protein S0 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps-0 PE=3 SV=2 4 287 5.0E-149
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4R188|RSSA_MAGO7 40S ribosomal protein S0 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RPS0 PE=3 SV=1 4 294 5.0E-164
sp|C7Z0Q8|RSSA_NECH7 40S ribosomal protein S0 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=RPS0 PE=3 SV=1 4 278 8.0E-161
sp|A7F2R3|RSSA_SCLS1 40S ribosomal protein S0 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rps0 PE=3 SV=1 4 294 3.0E-150
sp|B2B1Z3|RSSA_PODAN 40S ribosomal protein S0 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=RPS0 PE=3 SV=1 4 294 1.0E-149
sp|Q01291|RSSA_NEUCR 40S ribosomal protein S0 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rps-0 PE=3 SV=2 4 287 5.0E-149
sp|Q2GV75|RSSA_CHAGB 40S ribosomal protein S0 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RPS0 PE=3 SV=1 4 289 5.0E-148
sp|Q4WYK1|RSSA_ASPFU 40S ribosomal protein S0 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rps0 PE=3 SV=1 4 277 5.0E-147
sp|B0XWG9|RSSA_ASPFC 40S ribosomal protein S0 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rps0 PE=3 SV=1 4 277 5.0E-147
sp|Q0UR95|RSSA_PHANO 40S ribosomal protein S0 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RPS0 PE=3 SV=2 4 273 9.0E-147
sp|A6RMY2|RSSA_BOTFB 40S ribosomal protein S0 OS=Botryotinia fuckeliana (strain B05.10) GN=rps0 PE=3 SV=1 4 275 1.0E-146
sp|A1CL63|RSSA_ASPCL 40S ribosomal protein S0 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rps0 PE=3 SV=1 4 276 5.0E-146
sp|A1D695|RSSA_NEOFI 40S ribosomal protein S0 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rps0 PE=3 SV=1 4 277 1.0E-145
sp|B8M6L1|RSSA_TALSN 40S ribosomal protein S0 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=rps0 PE=3 SV=1 4 276 2.0E-144
sp|B2VY36|RSSA_PYRTR 40S ribosomal protein S0 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rps0 PE=3 SV=1 4 251 4.0E-144
sp|C1GUB6|RSSA_PARBA 40S ribosomal protein S0 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=RPS0 PE=3 SV=1 4 276 1.0E-143
sp|C1G1P4|RSSA_PARBD 40S ribosomal protein S0 OS=Paracoccidioides brasiliensis (strain Pb18) GN=RPS0 PE=3 SV=1 4 276 2.0E-143
sp|C0S3U2|RSSA_PARBP 40S ribosomal protein S0 OS=Paracoccidioides brasiliensis (strain Pb03) GN=RPS0 PE=3 SV=1 4 276 6.0E-143
sp|B6H2I7|RSSA_PENRW 40S ribosomal protein S0 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rps0 PE=3 SV=1 4 294 3.0E-142
sp|B6Q3G2|RSSA_TALMQ 40S ribosomal protein S0 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rps0 PE=3 SV=1 4 245 5.0E-142
sp|Q0CQF6|RSSA_ASPTN 40S ribosomal protein S0 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rps0 PE=3 SV=1 4 252 1.0E-141
sp|C5PA09|RSSA_COCP7 40S ribosomal protein S0 OS=Coccidioides posadasii (strain C735) GN=RPS0 PE=3 SV=1 4 270 7.0E-141
sp|Q1E1R2|RSSA_COCIM 40S ribosomal protein S0 OS=Coccidioides immitis (strain RS) GN=RPS0 PE=3 SV=1 4 270 7.0E-141
sp|Q5B8F8|RSSA_EMENI 40S ribosomal protein S0 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rps0 PE=3 SV=2 4 276 8.0E-141
sp|C4JYP8|RSSA_UNCRE 40S ribosomal protein S0 OS=Uncinocarpus reesii (strain UAMH 1704) GN=RPS0 PE=3 SV=1 4 247 2.0E-139
sp|C0NKW7|RSSA_AJECG 40S ribosomal protein S0 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=RPS0 PE=3 SV=1 4 277 3.0E-139
sp|Q2UBZ9|RSSA_ASPOR 40S ribosomal protein S0 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rps0 PE=3 SV=1 4 255 9.0E-139
sp|B8N513|RSSA_ASPFN 40S ribosomal protein S0 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rps0 PE=3 SV=1 4 255 9.0E-139
sp|A2QE32|RSSA_ASPNC 40S ribosomal protein S0 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rps0 PE=3 SV=1 4 294 5.0E-136
sp|C5FD74|RSSA_ARTOC 40S ribosomal protein S0 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=RPS0 PE=3 SV=1 4 281 3.0E-133
sp|C5JKQ2|RSSA_AJEDS 40S ribosomal protein S0 OS=Ajellomyces dermatitidis (strain SLH14081) GN=RPS0 PE=3 SV=1 4 247 6.0E-132
sp|C5G8P1|RSSA_AJEDR 40S ribosomal protein S0 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=RPS0 PE=3 SV=1 4 247 6.0E-132
sp|B6K1S2|RSSA2_SCHJY 40S ribosomal protein S0-B OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rps0b PE=3 SV=1 1 287 1.0E-119
sp|B6K2L2|RSSA3_SCHJY 40S ribosomal protein S0-C OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rps0c PE=3 SV=1 1 211 3.0E-117
sp|B6K180|RSSA1_SCHJY 40S ribosomal protein S0-A OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rps0a PE=3 SV=1 8 286 7.0E-117
sp|C5DDM1|RSSA_LACTC 40S ribosomal protein S0 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RPS0 PE=3 SV=1 6 212 9.0E-116
sp|Q6CN12|RSSA_KLULA 40S ribosomal protein S0 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS0 PE=1 SV=1 6 246 3.0E-115
sp|A3LRZ0|RSSA_PICST 40S ribosomal protein S0 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RPS0 PE=3 SV=1 6 232 6.0E-115
sp|Q9Y7L8|RSSA1_SCHPO 40S ribosomal protein S0-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps001 PE=1 SV=1 8 285 2.0E-114
sp|Q01661|RSSA_PNECA 40S ribosomal protein S0 OS=Pneumocystis carinii GN=RPS0 PE=2 SV=1 10 289 2.0E-114
sp|A5DZP6|RSSA_LODEL 40S ribosomal protein S0 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RPS0 PE=3 SV=1 6 222 6.0E-114
sp|A8N7C6|RSSA_COPC7 40S ribosomal protein S0 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=RPS0 PE=3 SV=1 7 294 8.0E-114
sp|B0D174|RSSA_LACBS 40S ribosomal protein S0 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=RPS0 PE=3 SV=1 6 251 4.0E-113
sp|C4Y2C6|RSSA_CLAL4 40S ribosomal protein S0 OS=Clavispora lusitaniae (strain ATCC 42720) GN=RPS0 PE=3 SV=1 6 223 4.0E-113
sp|C5DX17|RSSA_ZYGRC 40S ribosomal protein S0 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RPS0 PE=3 SV=1 6 219 6.0E-113
sp|Q75CQ9|RSSA_ASHGO 40S ribosomal protein S0 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS0 PE=3 SV=1 6 211 1.0E-112
sp|Q6BW39|RSSA_DEBHA 40S ribosomal protein S0 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPS0 PE=3 SV=3 6 229 1.0E-112
sp|A5DGG9|RSSA_PICGU 40S ribosomal protein S0 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPS0 PE=3 SV=1 6 229 3.0E-112
sp|A7TEU3|RSSA1_VANPO 40S ribosomal protein S0-A OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RPS0A PE=3 SV=1 6 211 9.0E-112
sp|C4YNR7|RSSA_CANAW 40S ribosomal protein S0 OS=Candida albicans (strain WO-1) GN=RPS0 PE=3 SV=1 6 212 2.0E-111
sp|O42817|RSSA_CANAL 40S ribosomal protein S0 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS0 PE=2 SV=2 6 212 2.0E-111
sp|A7TIJ7|RSSA2_VANPO 40S ribosomal protein S0-B OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RPS0B PE=3 SV=1 6 211 5.0E-111
sp|Q9P546|RSSA2_SCHPO 40S ribosomal protein S0-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps002 PE=1 SV=1 1 286 8.0E-111
sp|B9WEC5|RSSA_CANDC 40S ribosomal protein S0 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RPS0 PE=3 SV=1 6 212 9.0E-111
sp|Q96VK7|RSSA_CANTR 40S ribosomal protein S0 OS=Candida tropicalis GN=RPS0 PE=3 SV=1 6 212 4.0E-110
sp|Q6FJX4|RSSA_CANGA 40S ribosomal protein S0 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS0 PE=3 SV=1 6 212 4.0E-110
sp|B8PAR0|RSSA_POSPM 40S ribosomal protein S0 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=RPS0 PE=3 SV=1 7 211 3.0E-109
sp|P32905|RSSA1_YEAST 40S ribosomal protein S0-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS0A PE=1 SV=3 6 211 6.0E-109
sp|A6ZUM5|RSSA1_YEAS7 40S ribosomal protein S0-A OS=Saccharomyces cerevisiae (strain YJM789) GN=RPS0A PE=3 SV=1 6 211 6.0E-109
sp|B3LI22|RSSA1_YEAS1 40S ribosomal protein S0-A OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RPS0A PE=3 SV=1 6 211 6.0E-109
sp|C4QYK0|RSSA_PICPG 40S ribosomal protein S0 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=RPS0 PE=3 SV=1 6 211 1.0E-108
sp|P46654|RSSA2_YEAST 40S ribosomal protein S0-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS0B PE=1 SV=2 6 211 2.0E-108
sp|A7A0V3|RSSA2_YEAS7 40S ribosomal protein S0-B OS=Saccharomyces cerevisiae (strain YJM789) GN=RPS0B PE=3 SV=1 6 211 2.0E-108
sp|B3LT19|RSSA2_YEAS1 40S ribosomal protein S0-B OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RPS0B PE=3 SV=1 6 211 2.0E-108
sp|Q6CGM0|RSSA_YARLI 40S ribosomal protein S0 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS0 PE=3 SV=2 10 210 1.0E-107
sp|P0CQ56|RSSA_CRYNJ 40S ribosomal protein S0 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RPS0 PE=3 SV=1 6 211 9.0E-104
sp|P0CQ57|RSSA_CRYNB 40S ribosomal protein S0 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RPS0 PE=3 SV=1 6 211 9.0E-104
sp|A8PXY6|RSSA_MALGO 40S ribosomal protein S0 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=RPS0 PE=3 SV=1 8 212 7.0E-103
sp|B3RPX6|RSSA_TRIAD 40S ribosomal protein SA OS=Trichoplax adhaerens GN=TRIADDRAFT_49917 PE=3 SV=1 10 273 7.0E-100
sp|Q4P426|RSSA_USTMA 40S ribosomal protein S0 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RPS0 PE=3 SV=1 8 285 5.0E-98
sp|Q4QY71|RSSA_SPAAU 40S ribosomal protein SA OS=Sparus aurata GN=rpsa PE=2 SV=2 10 254 8.0E-98
sp|Q3ZM03|RSSA_XENLA 40S ribosomal protein SA OS=Xenopus laevis GN=rpsa PE=1 SV=1 10 266 2.0E-97
sp|Q6P8D1|RSSA_XENTR 40S ribosomal protein SA OS=Xenopus tropicalis GN=rpsa PE=2 SV=1 10 266 4.0E-97
sp|P08865|RSSA_HUMAN 40S ribosomal protein SA OS=Homo sapiens GN=RPSA PE=1 SV=4 10 291 6.0E-97
sp|Q2L9X0|RSSA_CHLAE 40S ribosomal protein SA OS=Chlorocebus aethiops GN=RPSA PE=2 SV=3 10 286 1.0E-96
sp|P14206|RSSA_MOUSE 40S ribosomal protein SA OS=Mus musculus GN=Rpsa PE=1 SV=4 10 286 2.0E-96
sp|A2Q0U8|RSSA_SOLSE 40S ribosomal protein SA OS=Solea senegalensis GN=rpsa PE=2 SV=1 10 253 2.0E-96
sp|P38983|RSSA_RAT 40S ribosomal protein SA OS=Rattus norvegicus GN=Rpsa PE=1 SV=3 10 286 2.0E-96
sp|A6YRY8|RSSA_SHEEP 40S ribosomal protein SA OS=Ovis aries GN=RPSA PE=2 SV=1 10 256 4.0E-96
sp|P26452|RSSA_BOVIN 40S ribosomal protein SA OS=Bos taurus GN=RPSA PE=2 SV=4 10 256 4.0E-96
sp|Q803F6|RSSA_DANRE 40S ribosomal protein SA OS=Danio rerio GN=rpsa PE=2 SV=1 10 229 6.0E-96
sp|B5DGB6|RSSA_SALSA 40S ribosomal protein SA OS=Salmo salar GN=rpsa PE=2 SV=1 10 253 8.0E-96
sp|A7RKS5|RSSA_NEMVE 40S ribosomal protein SA OS=Nematostella vectensis GN=v1g198553 PE=3 SV=1 10 211 9.0E-96
sp|Q4GWZ2|RSSA_PIG 40S ribosomal protein SA OS=Sus scrofa GN=RPSA PE=1 SV=3 10 285 1.0E-95
sp|P38982|RSSA_CRIGR 40S ribosomal protein SA OS=Cricetulus griseus GN=Rpsa PE=1 SV=3 10 286 2.0E-95
sp|Q90YS4|RSSA_ICTPU 40S ribosomal protein SA OS=Ictalurus punctatus GN=rpsa PE=2 SV=1 10 229 3.0E-95
sp|P50890|RSSA_CHICK 40S ribosomal protein SA OS=Gallus gallus GN=RPSA PE=3 SV=1 10 255 1.0E-94
sp|B5FXT6|RSSA_TAEGU 40S ribosomal protein SA OS=Taeniopygia guttata GN=RPSA PE=2 SV=1 10 223 1.0E-94
sp|A9UPA2|RSSA_MONBE 40S ribosomal protein SA OS=Monosiga brevicollis GN=30792 PE=3 SV=1 10 275 7.0E-94
sp|Q4KTE2|RSSA_SUBDO 40S ribosomal protein SA OS=Suberites domuncula PE=2 SV=1 10 246 7.0E-94
sp|P38984|RSSA_HYDVD 40S ribosomal protein SA OS=Hydra viridissima PE=2 SV=1 11 272 8.0E-92
sp|Q5UAP4|RSSA_BOMMO 40S ribosomal protein SA OS=Bombyx mori PE=2 SV=1 10 246 5.0E-91
sp|A6NA00|RSSA_ORNPR 40S ribosomal protein SA OS=Ornithodoros parkeri PE=2 SV=1 9 220 2.0E-90
sp|P38980|RSSA_TRIGR 40S ribosomal protein SA OS=Tripneustes gratilla PE=2 SV=1 11 211 4.0E-90
sp|B3P9J3|RSSA_DROER 40S ribosomal protein SA OS=Drosophila erecta GN=sta PE=3 SV=1 10 211 4.0E-90
sp|B4PY37|RSSA_DROYA 40S ribosomal protein SA OS=Drosophila yakuba GN=sta PE=2 SV=1 10 211 5.0E-90
sp|Q0H6L0|RSSA_DROTE 40S ribosomal protein SA OS=Drosophila teissieri GN=sta PE=3 SV=1 10 211 5.0E-90
sp|Q0H6L1|RSSA_DROSI 40S ribosomal protein SA OS=Drosophila simulans GN=sta PE=3 SV=1 10 211 5.0E-90
sp|B4I9F6|RSSA_DROSE 40S ribosomal protein SA OS=Drosophila sechellia GN=sta PE=3 SV=1 10 211 5.0E-90
sp|O80377|RSSA_DAUCA 40S ribosomal protein SA OS=Daucus carota GN=179B PE=2 SV=1 11 275 6.0E-90
sp|Q8MPF7|RSSA_TOXGO 40S ribosomal protein SA OS=Toxoplasma gondii PE=2 SV=1 11 276 7.0E-90
sp|Q0PXX8|RSSA_DIACI 40S ribosomal protein SA OS=Diaphorina citri PE=2 SV=1 10 218 8.0E-90
sp|A3RLT6|RSSA_PINFU 40S ribosomal protein SA OS=Pinctada fucata PE=2 SV=1 10 288 1.0E-89
sp|A8IB25|RSSA_CHLRE 40S ribosomal protein SA OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_126059 PE=3 SV=1 11 209 1.0E-89
sp|B4JXG8|RSSA_DROGR 40S ribosomal protein SA OS=Drosophila grimshawi GN=sta PE=3 SV=1 10 211 3.0E-89
sp|Q9ZSR8|RSSA_BRANA 40S ribosomal protein SA OS=Brassica napus GN=LRP PE=2 SV=1 11 278 3.0E-89
sp|B4MB32|RSSA_DROVI 40S ribosomal protein SA OS=Drosophila virilis GN=sta PE=3 SV=1 10 211 4.0E-89
sp|B4L760|RSSA_DROMO 40S ribosomal protein SA OS=Drosophila mojavensis GN=sta PE=3 SV=1 10 211 4.0E-89
sp|A5BUU4|RSSA_VITVI 40S ribosomal protein SA OS=Vitis vinifera GN=GSVIVT00034021001 PE=3 SV=1 11 221 4.0E-89
sp|P38979|RSSA_DROME 40S ribosomal protein SA OS=Drosophila melanogaster GN=sta PE=1 SV=2 10 211 6.0E-89
sp|B3MRX2|RSSA_DROAN 40S ribosomal protein SA OS=Drosophila ananassae GN=sta PE=3 SV=1 10 211 1.0E-88
sp|B4NPT0|RSSA_DROWI 40S ribosomal protein SA OS=Drosophila willistoni GN=sta PE=3 SV=1 10 211 1.0E-88
sp|Q8H173|RSSA2_ARATH 40S ribosomal protein Sa-2 OS=Arabidopsis thaliana GN=RPSaB PE=1 SV=2 17 265 2.0E-88
sp|A4RUK2|RSSA_OSTLU 40S ribosomal protein SA OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_12355 PE=3 SV=1 11 276 3.0E-88
sp|Q29J14|RSSA_DROPS 40S ribosomal protein SA OS=Drosophila pseudoobscura pseudoobscura GN=sta PE=3 SV=2 10 211 3.0E-88
sp|B4GTK1|RSSA_DROPE 40S ribosomal protein SA OS=Drosophila persimilis GN=sta PE=3 SV=1 10 211 3.0E-88
sp|O65751|RSSA_CICAR 40S ribosomal protein SA OS=Cicer arietinum GN=RAP40 PE=2 SV=1 11 251 5.0E-88
sp|Q08682|RSSA1_ARATH 40S ribosomal protein Sa-1 OS=Arabidopsis thaliana GN=RPSaA PE=1 SV=3 11 255 8.0E-88
sp|Q01CH5|RSSA_OSTTA 40S ribosomal protein SA OS=Ostreococcus tauri GN=Ot03g03240 PE=3 SV=2 11 211 1.0E-87
sp|O22518|RSSA_SOYBN 40S ribosomal protein SA OS=Glycine max PE=2 SV=1 8 209 3.0E-86
sp|Q7PZ81|RSSA_ANOGA 40S ribosomal protein SA OS=Anopheles gambiae GN=AGAP011777 PE=3 SV=3 10 229 2.0E-85
sp|A2I3Z2|RSSA_MACHI 40S ribosomal protein SA OS=Maconellicoccus hirsutus PE=2 SV=1 10 241 3.0E-85
sp|P38981|RSSA_URECA 40S ribosomal protein SA OS=Urechis caupo PE=2 SV=1 11 250 3.0E-85
sp|Q16ZR8|RSSA_AEDAE 40S ribosomal protein SA OS=Aedes aegypti GN=AAEL008083 PE=2 SV=2 10 218 7.0E-85
sp|Q8IJD4|RSSA_PLAF7 40S ribosomal protein SA OS=Plasmodium falciparum (isolate 3D7) GN=PF10_0264 PE=1 SV=1 16 252 1.0E-83
sp|A8XSS1|RSSA_CAEBR 40S ribosomal protein SA OS=Caenorhabditis briggsae GN=rps-0 PE=3 SV=1 14 271 1.0E-83
sp|B3L230|RSSA_PLAKH 40S ribosomal protein SA OS=Plasmodium knowlesi (strain H) GN=PKH_061110 PE=3 SV=1 16 212 4.0E-83
sp|Q55BY1|RSSA_DICDI 40S ribosomal protein SA OS=Dictyostelium discoideum GN=rpsA PE=1 SV=1 6 218 4.0E-83
sp|B0X6V0|RSSA_CULQU 40S ribosomal protein SA OS=Culex quinquefasciatus GN=CPIJ013899 PE=3 SV=2 10 246 4.0E-83
sp|A5KE24|RSSA_PLAVS 40S ribosomal protein SA OS=Plasmodium vivax (strain Salvador I) GN=PVX_111380 PE=3 SV=1 16 212 5.0E-83
sp|Q4Q0Q0|RSSA_LEIMA 40S ribosomal protein SA OS=Leishmania major GN=LmjF36.5010 PE=3 SV=1 1 211 6.0E-83
sp|A4IDS4|RSSA_LEIIN 40S ribosomal protein SA OS=Leishmania infantum GN=LinJ36.5570 PE=3 SV=1 1 211 1.0E-82
sp|Q7RBT0|RSSA_PLAYO 40S ribosomal protein SA OS=Plasmodium yoelii yoelii GN=PY06059 PE=3 SV=1 16 212 3.0E-82
sp|P46769|RSSA_CAEEL 40S ribosomal protein SA OS=Caenorhabditis elegans GN=rps-0 PE=1 SV=3 14 271 5.0E-82
sp|Q4Z694|RSSA_PLABA 40S ribosomal protein SA OS=Plasmodium berghei (strain Anka) GN=PB000415.00.0 PE=3 SV=1 16 212 9.0E-82
sp|Q4XZN2|RSSA_PLACH 40S ribosomal protein SA OS=Plasmodium chabaudi GN=PC000391.02.0 PE=3 SV=1 16 212 1.0E-81
sp|A4HQ28|RSSA_LEIBR 40S ribosomal protein SA OS=Leishmania braziliensis GN=LbrM35_V2.5370 PE=3 SV=1 1 211 1.0E-81
sp|A8Q2H5|RSSA_BRUMA 40S ribosomal protein SA OS=Brugia malayi GN=Bm1_41245 PE=3 SV=2 16 211 2.0E-79
sp|Q5CPC9|RSSA_CRYHO 40S ribosomal protein SA OS=Cryptosporidium hominis GN=Chro.30246 PE=3 SV=1 17 265 1.0E-78
sp|Q4U8U5|RSSA_THEAN 40S ribosomal protein SA OS=Theileria annulata GN=TA10185 PE=3 SV=1 9 221 1.0E-77
sp|Q4N1J1|RSSA_THEPA 40S ribosomal protein SA OS=Theileria parva GN=TP04_0748 PE=3 SV=1 9 221 3.0E-77
sp|Q5DA90|RSSA_SCHJA 40S ribosomal protein SA OS=Schistosoma japonicum GN=SJCHGC06078 PE=2 SV=1 11 267 8.0E-75
sp|A8BE86|RSSA_GIAIC 40S ribosomal protein SA OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_7766 PE=3 SV=1 17 206 2.0E-66
sp|P46770|RSSA_ECHGR 40S ribosomal protein SA OS=Echinococcus granulosus GN=egmo3 PE=1 SV=1 11 232 1.0E-62
sp|P46771|RSSA_STRPU 40S ribosomal protein SA (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 81 211 7.0E-59
sp|A5UN64|RS2_METS3 30S ribosomal protein S2 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps2 PE=3 SV=1 17 192 6.0E-54
sp|B7XHU4|RSSA_ENTBH 40S ribosomal protein S0 OS=Enterocytozoon bieneusi (strain H348) GN=RPS0 PE=3 SV=1 19 223 1.0E-52
sp|A1RWV4|RS2_THEPD 30S ribosomal protein S2 OS=Thermofilum pendens (strain Hrk 5) GN=rps2 PE=3 SV=1 18 192 4.0E-52
sp|Q97BQ4|RS2_THEVO 30S ribosomal protein S2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps2 PE=3 SV=2 26 192 9.0E-52
sp|Q8TV23|RS2_METKA 30S ribosomal protein S2 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps2 PE=3 SV=1 22 196 1.0E-51
sp|P57712|RS2_THEAC 30S ribosomal protein S2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps2 PE=3 SV=1 17 192 1.0E-51
sp|Q2NG04|RS2_METST 30S ribosomal protein S2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps2 PE=3 SV=1 18 203 4.0E-51
sp|Q9V191|RS2_PYRAB 30S ribosomal protein S2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps2 PE=3 SV=1 18 196 3.0E-50
sp|Q5JJD2|RS2_THEKO 30S ribosomal protein S2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps2 PE=3 SV=1 18 196 4.0E-50
sp|O59295|RS2_PYRHO 30S ribosomal protein S2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps2 PE=3 SV=2 18 196 6.0E-50
sp|A3DMR1|RS2_STAMF 30S ribosomal protein S2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps2 PE=3 SV=1 18 192 2.0E-49
sp|Q8U0F0|RS2_PYRFU 30S ribosomal protein S2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps2 PE=1 SV=1 18 196 2.0E-49
sp|O26150|RS2_METTH 30S ribosomal protein S2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps2 PE=3 SV=1 18 196 7.0E-49
sp|Q8TT39|RS2_METAC 30S ribosomal protein S2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps2 PE=3 SV=2 18 196 7.0E-48
sp|Q8PW41|RS2_METMA 30S ribosomal protein S2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps2 PE=3 SV=1 18 196 8.0E-48
sp|P95993|RS2_SULSO 30S ribosomal protein S2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps2 PE=3 SV=1 18 192 8.0E-48
sp|Q46CL0|RS2_METBF 30S ribosomal protein S2 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps2 PE=3 SV=2 18 196 1.0E-46
sp|A7IAG8|RS2_METB6 30S ribosomal protein S2 OS=Methanoregula boonei (strain 6A8) GN=rps2 PE=3 SV=1 18 190 5.0E-46
sp|A2BK84|RS2_HYPBU 30S ribosomal protein S2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps2 PE=3 SV=1 18 192 8.0E-46
sp|Q12TI2|RS2_METBU 30S ribosomal protein S2 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps2 PE=3 SV=1 18 196 1.0E-45
sp|A3CWI6|RS2_METMJ 30S ribosomal protein S2 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps2 PE=3 SV=1 18 205 2.0E-45
sp|Q0W8D0|RS2_METAR 30S ribosomal protein S2 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps2 PE=3 SV=1 22 190 6.0E-45
sp|P54109|RS2_METJA 30S ribosomal protein S2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps2 PE=3 SV=2 18 192 6.0E-45
sp|Q6L1Q0|RS2_PICTO 30S ribosomal protein S2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps2 PE=3 SV=1 26 192 1.0E-44
sp|A0B6E5|RS2_METTP 30S ribosomal protein S2 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps2 PE=3 SV=1 18 190 1.0E-44
sp|C4V7V1|RSSA_NOSCE 40S ribosomal protein S0 OS=Nosema ceranae (strain BRL01) GN=RPS0 PE=3 SV=1 18 224 5.0E-44
sp|A8A8X0|RS2_IGNH4 30S ribosomal protein S2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps2 PE=3 SV=1 18 192 1.0E-43
sp|A4YIM7|RS2_METS5 30S ribosomal protein S2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps2 PE=3 SV=1 18 192 3.0E-43
sp|A2SSV0|RS2_METLZ 30S ribosomal protein S2 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps2 PE=3 SV=1 11 192 6.0E-43
sp|A6UV20|RS2_META3 30S ribosomal protein S2 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps2 PE=3 SV=1 18 192 6.0E-43
sp|A6USE6|RS2_METVS 30S ribosomal protein S2 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps2 PE=3 SV=1 18 199 1.0E-42
sp|Q6LZG2|RS2_METMP 30S ribosomal protein S2 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps2 PE=3 SV=1 18 199 1.0E-42
sp|A6VJX3|RS2_METM7 30S ribosomal protein S2 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps2 PE=3 SV=1 18 199 1.0E-42
sp|A9A7B6|RS2_METM6 30S ribosomal protein S2 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps2 PE=3 SV=1 18 199 1.0E-42
sp|O29132|RS2_ARCFU 30S ribosomal protein S2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps2 PE=1 SV=1 22 190 1.0E-42
sp|Q8SS60|RSSA_ENCCU 40S ribosomal protein S0 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS0 PE=1 SV=1 18 244 2.0E-42
sp|A4FYC9|RS2_METM5 30S ribosomal protein S2 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps2 PE=3 SV=1 18 199 2.0E-42
sp|P39478|RS2_SULAC 30S ribosomal protein S2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps2 PE=3 SV=2 18 200 3.0E-42
sp|Q96YW5|RS2_SULTO 30S ribosomal protein S2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps2 PE=3 SV=1 18 192 8.0E-42
sp|Q2FTN4|RS2_METHJ 30S ribosomal protein S2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps2 PE=3 SV=1 11 200 3.0E-41
sp|Q18G63|RS2_HALWD 30S ribosomal protein S2 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps2 PE=3 SV=1 18 190 7.0E-41
sp|A4WH11|RS2_PYRAR 30S ribosomal protein S2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps2 PE=3 SV=1 18 192 1.0E-40
sp|P29202|RS2_HALMA 30S ribosomal protein S2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps2 PE=1 SV=2 18 190 1.0E-40
sp|P57713|RS2_HALSA 30S ribosomal protein S2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps2 PE=3 SV=1 18 190 1.0E-40
sp|B0R4Y9|RS2_HALS3 30S ribosomal protein S2 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps2 PE=3 SV=1 18 190 1.0E-40
sp|Q8ZYE2|RS2_PYRAE 30S ribosomal protein S2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps2 PE=3 SV=1 18 192 2.0E-40
sp|Q3IQS9|RS2_NATPD 30S ribosomal protein S2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps2 PE=3 SV=1 18 190 3.0E-40
sp|A1RTJ3|RS2_PYRIL 30S ribosomal protein S2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps2 PE=3 SV=1 18 192 6.0E-40
sp|A3MS50|RS2_PYRCJ 30S ribosomal protein S2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps2 PE=3 SV=1 18 192 2.0E-39
sp|B1YA42|RS2_PYRNV 30S ribosomal protein S2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps2 PE=3 SV=1 18 192 2.0E-39
sp|A8MC33|RS2_CALMQ 30S ribosomal protein S2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps2 PE=3 SV=1 18 192 2.0E-37
sp|B1L5N1|RS2_KORCO 30S ribosomal protein S2 OS=Korarchaeum cryptofilum (strain OPF8) GN=rps2 PE=3 SV=1 22 192 7.0E-37
sp|Q9YB45|RS2_AERPE 30S ribosomal protein S2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps2 PE=3 SV=1 19 192 3.0E-36
sp|Q74M65|RS2_NANEQ 30S ribosomal protein S2 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps2 PE=3 SV=1 18 192 6.0E-35
sp|A9A428|RS2_NITMS 30S ribosomal protein S2 OS=Nitrosopumilus maritimus (strain SCM1) GN=rps2 PE=3 SV=1 12 204 6.0E-33
sp|A0RY14|RS2_CENSY 30S ribosomal protein S2 OS=Cenarchaeum symbiosum (strain A) GN=rps2 PE=3 SV=1 20 192 6.0E-28
sp|Q1AW68|RS2_RUBXD 30S ribosomal protein S2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsB PE=3 SV=1 18 232 8.0E-10
sp|Q8EUG1|RS2_MYCPE 30S ribosomal protein S2 OS=Mycoplasma penetrans (strain HF-2) GN=rpsB PE=3 SV=1 117 232 1.0E-09
sp|B9EBD6|RS2_MACCJ 30S ribosomal protein S2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rpsB PE=3 SV=1 18 220 2.0E-09
sp|Q03FT6|RS2_PEDPA 30S ribosomal protein S2 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsB PE=3 SV=1 18 189 2.0E-09
sp|P49668|RS2_PEDAC 30S ribosomal protein S2 OS=Pediococcus acidilactici GN=rpsB PE=3 SV=1 18 189 6.0E-09
sp|B5ZAJ9|RS2_UREU1 30S ribosomal protein S2 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsB PE=3 SV=1 120 190 8.0E-09
sp|Q88VJ4|RS2_LACPL 30S ribosomal protein S2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsB PE=3 SV=1 18 189 9.0E-09
sp|Q2SSA8|RS2_MYCCT 30S ribosomal protein S2 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpsB PE=3 SV=1 115 181 2.0E-08
sp|Q9PRB9|RS2_UREPA 30S ribosomal protein S2 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsB PE=3 SV=1 120 190 3.0E-08
sp|B1AI12|RS2_UREP2 30S ribosomal protein S2 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsB PE=3 SV=1 120 190 3.0E-08
sp|B1MZ65|RS2_LEUCK 30S ribosomal protein S2 OS=Leuconostoc citreum (strain KM20) GN=rpsB PE=3 SV=2 21 189 4.0E-08
sp|P80371|RS2_THET8 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsB PE=1 SV=4 18 216 5.0E-08
sp|P62662|RS2_THET2 30S ribosomal protein S2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsB PE=1 SV=2 18 216 5.0E-08
sp|P32902|RT04_YEAST 37S ribosomal protein MRP4, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP4 PE=1 SV=1 18 183 5.0E-08
sp|Q5HGH6|RS2_STAAC 30S ribosomal protein S2 OS=Staphylococcus aureus (strain COL) GN=rpsB PE=3 SV=1 18 205 5.0E-08
sp|Q1WUL5|RS2_LACS1 30S ribosomal protein S2 OS=Lactobacillus salivarius (strain UCC118) GN=rpsB PE=3 SV=1 18 189 5.0E-08
sp|Q03WX5|RS2_LEUMM 30S ribosomal protein S2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsB PE=3 SV=1 21 189 8.0E-08
sp|A9NHC6|RS2_ACHLI 30S ribosomal protein S2 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsB PE=3 SV=1 18 232 1.0E-07
sp|A7HMF2|RS2_FERNB 30S ribosomal protein S2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsB PE=3 SV=1 18 177 2.0E-07
sp|Q04F88|RS2_OENOB 30S ribosomal protein S2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsB PE=3 SV=1 18 189 2.0E-07
sp|Q38W64|RS2_LACSS 30S ribosomal protein S2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsB PE=3 SV=1 122 189 3.0E-07
sp|P75560|RS2_MYCPN 30S ribosomal protein S2 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpsB PE=3 SV=1 117 216 4.0E-07
sp|P47316|RS2_MYCGE 30S ribosomal protein S2 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsB PE=3 SV=1 122 204 5.0E-07
sp|Q6F0Q4|RS2_MESFL 30S ribosomal protein S2 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsB PE=3 SV=2 36 177 1.0E-06
sp|Q98Q36|RS2_MYCPU 30S ribosomal protein S2 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsB PE=3 SV=1 21 210 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3526
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|9 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6154
Ophiocordyceps camponoti-floridani Ophcf2|05790
Ophiocordyceps camponoti-rufipedis Ophun1|3742
Ophiocordyceps kimflemingae Ophio5|7166
Ophiocordyceps subramaniannii Hirsu2|6770

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|9
MAPPPSFPSILNATSQDIEMLLAAQCHLGSKNLQVHMEPYLWKTRADGVNIVNIGKTWEKIVLAARIIVAIDNPA
DICVISARPYGQRAVLKFAAHTGASSIAGRFTPGSFTNYITRSFKEPRLIVVTDPRTDAQAIKEASYVNIPVIAL
CDTDSPTEYVDVAIPTNNKGRNAIGTIWWLLAREVLRLRGTIYNRETPWDVMPDLYFYRDPEAEAEDKVEEDKLP
GVDEQGPAVIETGVAGTGGDWEVPAAGFTGAAAATGWDGAEAGGEWSAAGAASGTAPSEWADGSKDAHW*
Coding >OphauG2|9
ATGGCTCCCCCTCCTAGTTTTCCCTCGATTCTCAATGCGACAAGCCAGGACATTGAGATGCTCTTGGCGGCTCAA
TGTCATCTTGGAAGCAAGAATCTCCAAGTCCACATGGAGCCCTATCTGTGGAAGACTCGAGCTGATGGTGTAAAC
ATTGTAAACATTGGCAAGACCTGGGAGAAGATTGTTCTGGCCGCCCGCATCATCGTCGCCATTGACAACCCTGCC
GACATTTGCGTCATCTCGGCCCGTCCCTACGGCCAGCGCGCCGTGCTCAAGTTTGCCGCTCACACAGGCGCCTCG
TCTATTGCTGGCCGTTTTACTCCTGGTAGCTTCACCAACTACATCACGCGCTCCTTCAAGGAGCCGCGCCTCATT
GTCGTGACGGATCCTCGCACCGATGCCCAGGCCATCAAGGAGGCCAGCTACGTTAACATACCCGTCATCGCTCTC
TGCGACACTGACTCTCCTACCGAGTACGTCGACGTTGCCATTCCCACCAACAACAAGGGTCGCAACGCCATTGGT
ACTATTTGGTGGCTTCTCGCCCGCGAAGTCCTTCGCCTTCGCGGCACCATCTACAACCGAGAAACACCCTGGGAC
GTGATGCCCGATTTGTACTTTTACCGTGATCCCGAGGCCGAGGCTGAGGACAAGGTCGAGGAGGACAAGCTTCCC
GGCGTTGACGAGCAGGGCCCCGCCGTCATTGAGACTGGCGTTGCTGGTACCGGCGGCGACTGGGAGGTCCCCGCT
GCTGGCTTCACTGGTGCTGCTGCTGCGACTGGGTGGGATGGCGCAGAGGCTGGTGGTGAATGGAGCGCCGCTGGT
GCCGCCTCTGGCACTGCTCCGTCCGAATGGGCCGATGGTTCCAAAGATGCTCATTGGTAG
Transcript >OphauG2|9
ATGGCTCCCCCTCCTAGTTTTCCCTCGATTCTCAATGCGACAAGCCAGGACATTGAGATGCTCTTGGCGGCTCAA
TGTCATCTTGGAAGCAAGAATCTCCAAGTCCACATGGAGCCCTATCTGTGGAAGACTCGAGCTGATGGTGTAAAC
ATTGTAAACATTGGCAAGACCTGGGAGAAGATTGTTCTGGCCGCCCGCATCATCGTCGCCATTGACAACCCTGCC
GACATTTGCGTCATCTCGGCCCGTCCCTACGGCCAGCGCGCCGTGCTCAAGTTTGCCGCTCACACAGGCGCCTCG
TCTATTGCTGGCCGTTTTACTCCTGGTAGCTTCACCAACTACATCACGCGCTCCTTCAAGGAGCCGCGCCTCATT
GTCGTGACGGATCCTCGCACCGATGCCCAGGCCATCAAGGAGGCCAGCTACGTTAACATACCCGTCATCGCTCTC
TGCGACACTGACTCTCCTACCGAGTACGTCGACGTTGCCATTCCCACCAACAACAAGGGTCGCAACGCCATTGGT
ACTATTTGGTGGCTTCTCGCCCGCGAAGTCCTTCGCCTTCGCGGCACCATCTACAACCGAGAAACACCCTGGGAC
GTGATGCCCGATTTGTACTTTTACCGTGATCCCGAGGCCGAGGCTGAGGACAAGGTCGAGGAGGACAAGCTTCCC
GGCGTTGACGAGCAGGGCCCCGCCGTCATTGAGACTGGCGTTGCTGGTACCGGCGGCGACTGGGAGGTCCCCGCT
GCTGGCTTCACTGGTGCTGCTGCTGCGACTGGGTGGGATGGCGCAGAGGCTGGTGGTGAATGGAGCGCCGCTGGT
GCCGCCTCTGGCACTGCTCCGTCCGAATGGGCCGATGGTTCCAAAGATGCTCATTGGTAG
Gene >OphauG2|9
ATGGCTCCCCCTCCTAGTTTTCCCTCGATTCTCAATGCGACAAGCCAGGACATTGAGATGCTCTTGGCGGCTCAA
TGTCATCTTGGAAGCAAGAATCTCCAAGTCCACATGGAGCCCTATCTGTGGAAGACTCGAGCTGATGGTGTAAAC
ATTGTAAACATTGGCAAGACCTGGTTCGTGGCCACATTGGCTGCATAGACCTGGTGGCAAAGAGGCTGACAAGGC
CATAGGGAGAAGATTGTTCTGGCCGCCCGCATCATCGTCGCCATTGACAACCCTGCCGACATTTGCGTCATCTCG
GCCCGTCCCTACGGCCAGCGCGCCGTGCTCAAGTTTGCCGCTCACACAGGCGCCTCGTCTATTGCTGGCCGTTTT
ACTCCTGGTAGCTTCACCAACTACATCACGCGCTCCTTCAAGGAGCCGCGCCTCATTGTCGTGACGGATCCTCGC
ACCGATGCCCAGGCCATCAAGGAGGCCAGCTACGTTAACATACCCGTCATCGCTCTCTGCGACACTGACTCTCCT
ACCGAGTACGTCGACGTTGCCATTCCCACCAACAACAAGGGTCGCAACGCCATTGGTACTATTTGGTGGCTTCTC
GCCCGCGAAGTCCTTCGCCTTCGCGGCACCATCTACAACCGAGAAACACCCTGGGACGTGATGCCCGATTTGTAC
TTTTGTAAGTACTTTCGAAAATCCCACTTGCTTCCGTCTTGTGCTGACTTGTACTTGTAGACCGTGATCCCGAGG
CCGAGGCTGAGGACAAGGTCGAGGAGGACAAGCTTCCCGGCGTTGACGAGCAGGGCCCCGCCGTCATTGAGACTG
GCGTTGCTGGTACCGGCGGCGACTGGGAGGTCCCCGCTGCTGGCTTCACTGGTGCTGCTGCTGCGACTGGGTGGG
ATGGCGCAGAGGCTGGTGGTGAATGGAGCGCCGCTGGTGCCGCCTCTGGCACTGCTCCGTCCGAATGGGCCGATG
GTTCCAAAGATGCTCATTGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail