Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|89
Gene name
LocationContig_1002:1080..3400
Strand+
Gene length (bp)2320
Transcript length (bp)1977
Coding sequence length (bp)1977
Protein length (aa) 659

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01915 Glyco_hydro_3_C Glycosyl hydrolase family 3 C-terminal domain 4.9E-37 253 523
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 5.3E-32 1 204
PF14310 Fn3-like Fibronectin type III-like domain 6.9E-23 576 642

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 1 650 0.0E+00
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 1 650 0.0E+00
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 1 650 0.0E+00
sp|A5ABF5|BGLM_ASPNC Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglM PE=3 SV=1 1 653 0.0E+00
sp|B8N5S6|BGLM_ASPFN Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglM PE=3 SV=1 1 653 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1D122|BGLM_NEOFI Probable beta-glucosidase M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglM PE=3 SV=1 1 650 0.0E+00
sp|Q4WR62|BGLM_ASPFU Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglM PE=3 SV=1 1 650 0.0E+00
sp|B0XPB8|BGLM_ASPFC Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglM PE=3 SV=1 1 650 0.0E+00
sp|A5ABF5|BGLM_ASPNC Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglM PE=3 SV=1 1 653 0.0E+00
sp|B8N5S6|BGLM_ASPFN Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglM PE=3 SV=1 1 653 0.0E+00
sp|Q2UDK7|BGLM_ASPOR Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglM PE=3 SV=1 1 653 0.0E+00
sp|Q5AWD4|BGLM_EMENI Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglM PE=3 SV=1 1 648 0.0E+00
sp|Q0C7L4|BGLM_ASPTN Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglM PE=3 SV=1 1 653 0.0E+00
sp|G4N7Z0|CEL3B_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3B PE=1 SV=1 1 653 0.0E+00
sp|Q2U325|BGLG_ASPOR Probable beta-glucosidase G OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglG PE=3 SV=1 1 645 2.0E-158
sp|B8NMR5|BGLG_ASPFN Probable beta-glucosidase G OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglG PE=3 SV=1 1 645 2.0E-158
sp|Q5B0F4|BGLG_EMENI Probable beta-glucosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglG PE=3 SV=2 1 645 4.0E-156
sp|A1DC16|BGLG_NEOFI Probable beta-glucosidase G OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglG PE=3 SV=1 1 645 4.0E-152
sp|Q0CUC1|BGLG_ASPTN Probable beta-glucosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglG PE=3 SV=1 1 645 2.0E-151
sp|Q0CEF3|BGLL_ASPTN Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglL PE=3 SV=1 1 653 3.0E-148
sp|Q4WGT3|BGLL_ASPFU Probable beta-glucosidase L OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglL PE=3 SV=1 1 655 5.0E-148
sp|B0YB65|BGLL_ASPFC Probable beta-glucosidase L OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglL PE=3 SV=1 1 655 5.0E-148
sp|A1DCV5|BGLL_NEOFI Probable beta-glucosidase L OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglL PE=3 SV=1 1 655 3.0E-147
sp|G4NI45|CEL3A_MAGO7 Beta-glucosidase cel3A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel3A PE=1 SV=1 4 653 1.0E-142
sp|Q5B9F2|BGLL_EMENI Probable beta-glucosidase L OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglL PE=3 SV=1 1 653 1.0E-142
sp|A2QPK4|BGLD_ASPNC Probable beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglD PE=3 SV=2 1 653 2.0E-141
sp|B8NJF4|BGLD_ASPFN Probable beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglD PE=3 SV=2 1 654 1.0E-134
sp|Q2UNR0|BGLD_ASPOR Probable beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglD PE=3 SV=1 1 654 3.0E-134
sp|Q4WD56|BGLE_ASPFU Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglE PE=3 SV=1 1 649 4.0E-121
sp|B0YD91|BGLE_ASPFC Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglE PE=3 SV=1 1 649 4.0E-121
sp|A1DLJ5|BGLE_NEOFI Probable beta-glucosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglE PE=3 SV=1 1 649 2.0E-119
sp|A1CMH6|BGLE_ASPCL Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglE PE=3 SV=1 1 648 9.0E-115
sp|Q2UN12|BGLF_ASPOR Probable beta-glucosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglF PE=3 SV=1 1 645 7.0E-114
sp|B8NP65|BGLF_ASPFN Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglF PE=3 SV=1 1 645 9.0E-114
sp|Q2UTX5|BGLE_ASPOR Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglE PE=3 SV=2 1 649 7.0E-113
sp|D4AN50|BGLA_ARTBC Probable beta-glucosidase ARB_05654 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05654 PE=1 SV=1 1 533 1.0E-111
sp|Q5B5S8|BGLA_EMENI Probable beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglA PE=3 SV=2 1 651 2.0E-110
sp|D0VKF5|BGLA_ASPTE Probable beta-glucosidase A OS=Aspergillus terreus GN=bglA PE=2 SV=1 1 651 2.0E-108
sp|Q0CTD7|BGLA_ASPTN Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglA PE=3 SV=1 1 651 2.0E-107
sp|B8NRX2|BGLA_ASPFN Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglA PE=3 SV=1 1 533 4.0E-107
sp|Q2UUD6|BGLA_ASPOR Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglA PE=3 SV=1 1 533 5.0E-107
sp|Q0CI67|BGLF_ASPTN Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglF PE=3 SV=1 1 543 9.0E-106
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 85 653 6.0E-105
sp|Q5AYH8|BGLE_EMENI Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglE PE=3 SV=1 1 541 1.0E-104
sp|P22507|BGL2_SACFI Beta-glucosidase 2 OS=Saccharomycopsis fibuligera GN=BGL2 PE=3 SV=1 1 535 1.0E-104
sp|P87076|BGLA_ASPKW Beta-glucosidase A OS=Aspergillus kawachii (strain NBRC 4308) GN=bglA PE=1 SV=2 1 651 1.0E-104
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 1 544 3.0E-104
sp|P48825|BGL1_ASPAC Beta-glucosidase 1 OS=Aspergillus aculeatus PE=1 SV=1 1 552 5.0E-104
sp|Q5B681|BGLN_EMENI Probable beta-glucosidase N OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglN PE=3 SV=1 82 653 2.0E-103
sp|A2RAL4|BGLA_ASPNC Probable beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglA PE=3 SV=1 1 651 8.0E-103
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 1 535 9.0E-103
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 1 535 9.0E-103
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 1 544 1.0E-102
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 1 541 5.0E-102
sp|A1D451|BGLA_NEOFI Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglA PE=3 SV=1 1 535 7.0E-102
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 1 543 8.0E-102
sp|A1CR85|BGLA_ASPCL Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglA PE=3 SV=1 1 533 2.0E-101
sp|P22506|BGL1_SACFI Beta-glucosidase 1 OS=Saccharomycopsis fibuligera GN=BGL1 PE=3 SV=1 1 535 2.0E-99
sp|P06835|BGLS_WICAO Beta-glucosidase OS=Wickerhamomyces anomalus PE=3 SV=1 1 535 1.0E-98
sp|P14002|BGLB_CLOTH Thermostable beta-glucosidase B OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=bglB PE=1 SV=2 1 653 1.0E-76
sp|F6C6C1|APY_BIFBA Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) GN=HMPREF9228_1477 PE=1 SV=1 1 645 6.0E-57
sp|E7CY69|APY_BIFLN Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum GN=apy PE=1 SV=1 1 645 9.0E-52
sp|A7LXS8|BGH3A_BACO1 Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02644 PE=1 SV=1 1 645 7.0E-45
sp|Q56078|BGLX_SALTY Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bglX PE=3 SV=2 9 653 2.0E-37
sp|P33363|BGLX_ECOLI Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) GN=bglX PE=1 SV=2 9 645 2.0E-35
sp|Q5BA18|BGLK_EMENI Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglK PE=2 SV=1 387 653 5.0E-34
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 1 278 7.0E-34
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 1 278 8.0E-34
sp|Q23892|GLUA_DICDI Lysosomal beta glucosidase OS=Dictyostelium discoideum GN=gluA PE=1 SV=2 29 648 1.0E-33
sp|A1DPG0|BGLH_NEOFI Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglH PE=3 SV=1 378 655 1.0E-33
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 1 278 2.0E-33
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 1 278 2.0E-33
sp|Q5BFG8|BGLB_EMENI Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglB PE=1 SV=1 1 279 2.0E-33
sp|Q2U8Y5|BGLI_ASPOR Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglI PE=3 SV=1 375 638 6.0E-33
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 1 279 6.0E-33
sp|A1DNN8|BGLJ_NEOFI Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglJ PE=3 SV=1 378 655 7.0E-33
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 1 279 8.0E-33
sp|B8NDE2|BGLI_ASPFN Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglI PE=3 SV=2 375 638 1.0E-32
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 1 279 1.0E-32
sp|Q4WU49|BGLI_ASPFU Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglI PE=3 SV=1 363 653 3.0E-32
sp|B0Y3M6|BGLI_ASPFC Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglI PE=3 SV=1 385 653 3.0E-32
sp|P27034|BGLS_RHIRD Beta-glucosidase OS=Rhizobium radiobacter GN=cbg-1 PE=3 SV=1 1 284 5.0E-32
sp|P27034|BGLS_RHIRD Beta-glucosidase OS=Rhizobium radiobacter GN=cbg-1 PE=3 SV=1 385 653 6.0E-32
sp|Q0CAF5|BGLI_ASPTN Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglI PE=3 SV=1 1 278 6.0E-32
sp|Q5B6C7|BGLH_EMENI Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglH PE=3 SV=2 370 653 1.0E-31
sp|A1CUR8|BGLH_ASPCL Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglH PE=3 SV=1 343 653 1.0E-31
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 363 653 3.0E-31
sp|A1CA51|BGLI_ASPCL Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglI PE=3 SV=1 1 279 3.0E-31
sp|Q4WL79|BGLH_ASPFU Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglH PE=3 SV=1 378 655 3.0E-31
sp|B0XM94|BGLH_ASPFC Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglH PE=3 SV=1 378 655 3.0E-31
sp|Q5BFG8|BGLB_EMENI Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglB PE=1 SV=1 363 653 5.0E-31
sp|A2R989|BGLI_ASPNC Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=bglI PE=3 SV=1 370 638 7.0E-31
sp|Q5BA18|BGLK_EMENI Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglK PE=2 SV=1 1 291 1.0E-30
sp|Q0CAF5|BGLI_ASPTN Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglI PE=3 SV=1 385 645 2.0E-30
sp|Q5AV15|BGLJ_EMENI Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglJ PE=3 SV=1 1 272 2.0E-30
sp|A1DFA8|BGLI_NEOFI Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglI PE=3 SV=1 385 653 3.0E-30
sp|A7LXU3|BGH3B_BACO1 Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02659 PE=1 SV=1 21 640 3.0E-30
sp|Q5BB53|BGLI_EMENI Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglI PE=2 SV=2 353 638 1.0E-28
sp|Q2U9M7|BGLH_ASPOR Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglH PE=3 SV=2 378 655 1.0E-28
sp|B8NPL7|BGLH_ASPFN Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglH PE=3 SV=1 378 655 1.0E-28
sp|Q4WLY1|BGLJ_ASPFU Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglJ PE=3 SV=2 378 636 1.0E-28
sp|B0Y8M8|BGLJ_ASPFC Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglJ PE=3 SV=2 378 636 2.0E-28
sp|Q4WLY1|BGLJ_ASPFU Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglJ PE=3 SV=2 1 277 3.0E-28
sp|B0Y8M8|BGLJ_ASPFC Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglJ PE=3 SV=2 1 277 3.0E-28
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 378 649 5.0E-28
sp|P07337|BGLS_KLUMA Beta-glucosidase OS=Kluyveromyces marxianus PE=3 SV=1 328 656 6.0E-27
sp|Q4WA69|BGLK_ASPFU Probable beta-glucosidase K OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglK PE=3 SV=1 1 284 1.0E-26
sp|A1DNN8|BGLJ_NEOFI Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglJ PE=3 SV=1 1 203 4.0E-26
sp|Q94KD8|BXL2_ARATH Probable beta-D-xylosidase 2 OS=Arabidopsis thaliana GN=BXL2 PE=2 SV=1 26 650 9.0E-26
sp|P29091|BGLS_SCHCO Beta-glucosidase (Fragment) OS=Schizophyllum commune PE=2 SV=1 401 517 2.0E-25
sp|Q5AV15|BGLJ_EMENI Probable beta-glucosidase J OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglJ PE=3 SV=1 378 645 1.0E-24
sp|Q9P6J6|BGLS_SCHPO Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.04 PE=3 SV=1 1 166 2.0E-24
sp|Q9LJN4|BXL5_ARATH Probable beta-D-xylosidase 5 OS=Arabidopsis thaliana GN=BXL5 PE=2 SV=2 26 642 3.0E-24
sp|Q2U9M7|BGLH_ASPOR Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglH PE=3 SV=2 1 284 1.0E-23
sp|B8NPL7|BGLH_ASPFN Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglH PE=3 SV=1 1 284 1.0E-23
sp|P16084|BGLS_BUTFI Beta-glucosidase A OS=Butyrivibrio fibrisolvens GN=bglA PE=3 SV=1 403 641 3.0E-23
sp|Q5B6C7|BGLH_EMENI Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglH PE=3 SV=2 1 284 2.0E-22
sp|A1CUR8|BGLH_ASPCL Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglH PE=3 SV=1 1 284 4.0E-22
sp|P15885|BGLS_RUMAL Beta-glucosidase OS=Ruminococcus albus PE=3 SV=1 1 234 5.0E-22
sp|A5JTQ3|XYL2_MEDSV Beta-xylosidase/alpha-L-arabinofuranosidase 2 OS=Medicago sativa subsp. varia GN=Xyl2 PE=2 SV=1 26 640 2.0E-21
sp|A1DPG0|BGLH_NEOFI Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglH PE=3 SV=1 1 284 7.0E-21
sp|P07337|BGLS_KLUMA Beta-glucosidase OS=Kluyveromyces marxianus PE=3 SV=1 1 166 7.0E-21
sp|Q4WL79|BGLH_ASPFU Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglH PE=3 SV=1 1 284 1.0E-20
sp|B0XM94|BGLH_ASPFC Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglH PE=3 SV=1 1 284 1.0E-20
sp|Q9LXD6|BXL3_ARATH Beta-D-xylosidase 3 OS=Arabidopsis thaliana GN=BXL3 PE=1 SV=1 26 640 1.0E-20
sp|B0YBJ3|BGLK_ASPFC Probable beta-glucosidase K OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglK PE=3 SV=1 39 284 3.0E-20
sp|Q9FLG1|BXL4_ARATH Beta-D-xylosidase 4 OS=Arabidopsis thaliana GN=BXL4 PE=1 SV=1 26 648 4.0E-20
sp|Q9FGY1|BXL1_ARATH Beta-D-xylosidase 1 OS=Arabidopsis thaliana GN=BXL1 PE=1 SV=1 26 648 2.0E-19
sp|D5EY15|XYL3A_PRER2 Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyl3A PE=1 SV=1 433 648 4.0E-19
sp|A5JTQ2|XYL1_MEDSV Beta-xylosidase/alpha-L-arabinofuranosidase 1 (Fragment) OS=Medicago sativa subsp. varia GN=Xyl1 PE=1 SV=1 26 648 4.0E-19
sp|P15885|BGLS_RUMAL Beta-glucosidase OS=Ruminococcus albus PE=3 SV=1 375 640 1.0E-16
sp|D5EY15|XYL3A_PRER2 Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=xyl3A PE=1 SV=1 26 296 1.0E-16
sp|A1CCL9|BXLB_ASPCL Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bxlB PE=3 SV=2 16 619 2.0E-16
sp|Q9LXA8|BXL6_ARATH Probable beta-D-xylosidase 6 OS=Arabidopsis thaliana GN=BXL6 PE=2 SV=1 57 610 3.0E-16
sp|P22507|BGL2_SACFI Beta-glucosidase 2 OS=Saccharomycopsis fibuligera GN=BGL2 PE=3 SV=1 534 639 1.0E-15
sp|Q5BAS1|XYND_EMENI Exo-1,4-beta-xylosidase xlnD OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xlnD PE=1 SV=1 28 640 2.0E-15
sp|A1DJS5|XYND_NEOFI Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xlnD PE=3 SV=1 16 619 8.0E-15
sp|P16084|BGLS_BUTFI Beta-glucosidase A OS=Butyrivibrio fibrisolvens GN=bglA PE=3 SV=1 10 196 1.0E-14
sp|B0XP71|XYND_ASPFC Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xlnD PE=3 SV=1 36 640 1.0E-14
sp|P48825|BGL1_ASPAC Beta-glucosidase 1 OS=Aspergillus aculeatus PE=1 SV=1 540 651 2.0E-14
sp|Q4WRB0|XYND_ASPFU Probable exo-1,4-beta-xylosidase xlnD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xlnD PE=2 SV=1 39 640 2.0E-14
sp|Q0CB82|BXLB_ASPTN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bxlB PE=3 SV=1 1 619 2.0E-14
sp|Q4WFI6|BXLB_ASPFU Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bxlB PE=3 SV=1 16 619 2.0E-14
sp|B0Y0I4|BXLB_ASPFC Probable exo-1,4-beta-xylosidase bxlB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bxlB PE=3 SV=1 16 619 2.0E-14
sp|B8NRX2|BGLA_ASPFN Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bglA PE=3 SV=1 549 651 3.0E-14
sp|Q2UUD6|BGLA_ASPOR Probable beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bglA PE=3 SV=1 549 651 3.0E-14
sp|A1CR85|BGLA_ASPCL Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=bglA PE=3 SV=1 550 648 4.0E-14
sp|A1D451|BGLA_NEOFI Probable beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglA PE=3 SV=1 550 648 1.0E-13
sp|Q4WJJ3|BGLA_ASPFU Probable beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglA PE=3 SV=1 550 648 2.0E-13
sp|B0XPE1|BGLA_ASPFC Probable beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglA PE=3 SV=1 550 648 2.0E-13
sp|O00089|XYND_ASPNG Exo-1,4-beta-xylosidase xlnD OS=Aspergillus niger GN=xlnD PE=1 SV=2 28 535 2.0E-13
sp|A2QA27|XYND_ASPNC Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xlnD PE=3 SV=1 28 535 2.0E-13
sp|B6EY09|XYND_ASPJA Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus japonicus GN=xlnD PE=1 SV=1 39 640 2.0E-13
sp|C0STH4|XYND_ASPAC Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus aculeatus GN=xlnD PE=3 SV=1 39 640 3.0E-13
sp|Q9SGZ5|BXL7_ARATH Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana GN=BXL7 PE=2 SV=2 26 647 4.0E-13
sp|Q5ATH9|BXLB_EMENI Exo-1,4-beta-xylosidase bxlB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bxlB PE=1 SV=1 39 653 5.0E-13
sp|Q4AEG8|XYND_ASPAW Exo-1,4-beta-xylosidase xlnD OS=Aspergillus awamori GN=xlnD PE=2 SV=1 28 535 8.0E-13
sp|A1CND4|XYND_ASPCL Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xlnD PE=3 SV=2 36 647 1.0E-12
sp|B8MYV0|XYND_ASPFN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xlnD PE=3 SV=1 39 640 3.0E-12
sp|P40406|NAGZ_BACSU Beta-hexosaminidase OS=Bacillus subtilis (strain 168) GN=nagZ PE=1 SV=1 1 204 3.0E-12
sp|P22506|BGL1_SACFI Beta-glucosidase 1 OS=Saccharomycopsis fibuligera GN=BGL1 PE=3 SV=1 534 639 5.0E-12
sp|Q2TYT2|BXLB_ASPOR Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bxlB PE=3 SV=1 16 619 5.0E-12
sp|Q5B6C6|BGLF_EMENI Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglF PE=3 SV=2 543 658 1.0E-11
sp|Q0CI67|BGLF_ASPTN Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bglF PE=3 SV=1 555 628 2.0E-11
sp|B8NYD8|BXLB_ASPFN Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=bxlB PE=3 SV=1 16 619 3.0E-11
sp|B0Y7Q8|BGLF_ASPFC Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=bglF PE=3 SV=2 543 628 1.0E-10
sp|Q4WMU3|BGLF_ASPFU Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bglF PE=3 SV=2 543 628 1.0E-10
sp|A1DMR8|BGLF_NEOFI Probable beta-glucosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=bglF PE=3 SV=1 543 628 1.0E-10
sp|Q5AUW5|BGLD_EMENI Probable beta-glucosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglD PE=3 SV=2 1 73 3.0E-10
sp|P83344|XYNB_PRUPE Putative beta-D-xylosidase (Fragment) OS=Prunus persica PE=2 SV=1 234 648 2.0E-09
sp|Q0CMH8|XYND_ASPTN Probable exo-1,4-beta-xylosidase xlnD OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xlnD PE=3 SV=2 403 640 4.0E-08
sp|Q5BCC6|BGLC_EMENI Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bglC PE=1 SV=1 49 267 5.0E-08
sp|Q7WUL3|NAG3_CELFI Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi GN=nag3 PE=1 SV=1 1 275 2.0E-07
sp|Q2UR38|XYND_ASPOR Exo-1,4-beta-xylosidase xlnD OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xlnD PE=1 SV=1 383 640 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|89
MGAEFRKKGINVHLGPTIGPLGRVVRGGRNWEGFAADAYLAGVMGGASVEGMQSQGVQSCAKHYIANEQETNRMV
LDKGESVSSNLDDRTMHEVYLWPFQNAVKAGVVNVMCSYQRVNNSYACSNSKILNGLLKTELGFQGFVVTDWKAN
FAGPDAAPAGLDMAMPDGTLVMGQQAWGQPLLDAVRNGSVPETRLDDMVTRILSPWFLLNQDSILPNPGIGKIDN
VTQPHPIIDARDPSSRPILFQDAVQGHVLVKNTKSTLPLNSPRLISLFGYSAKSPDLFGPSFGSEADGWASGTEP
INYDEFFQNTWLMSKNHTRSVIGINGTMIGAAGSAAVAPAVFTAPFESLKVRAARDDTAVFFDFVSAEPAVDPVS
DACIVFGNAWASEGYDRPAISDEYTDTLINAVADQCEKTIVVLHNAGIRLADPFITHDNVTAVIYAHLPGRDSGD
AIVSLLYGESNPSGKLPYTVAKKSSDYGSLLNPDDPNSTFPQSTFVEGIYLDYKHFEKNNISPRFEFGFGLSYTS
FSMSSLDITSPASLPAYPTGAVVSGGQTDLWDTVATVKLDVCNSGPVPGAEVVQLYVYMPGEPVKQLRGFERVML
QPGEVQSVTLELMRRDLSRWDTVAQKWRLDCGRYRVLVGNSSCNLPLQGSVEVWRDEC*
Coding >OphauG2|89
ATGGGCGCCGAGTTTAGGAAAAAAGGCATCAACGTCCATCTCGGCCCCACCATCGGGCCCCTGGGGCGCGTTGTT
CGCGGCGGGAGGAACTGGGAGGGCTTTGCGGCCGATGCGTACCTTGCGGGGGTCATGGGCGGCGCATCGGTAGAG
GGGATGCAGAGCCAGGGCGTGCAATCCTGCGCCAAGCATTACATTGCAAATGAGCAAGAGACGAATCGCATGGTC
TTGGACAAGGGCGAATCCGTGTCGTCGAACCTTGACGACAGGACGATGCATGAAGTCTATCTCTGGCCGTTTCAA
AACGCCGTCAAGGCGGGTGTTGTAAACGTCATGTGTTCATACCAGCGCGTCAACAACTCGTACGCGTGCTCTAAT
AGCAAGATCCTAAACGGGCTGTTGAAAACAGAGCTCGGGTTCCAGGGCTTCGTCGTTACCGATTGGAAGGCAAAC
TTTGCAGGCCCAGATGCTGCTCCGGCGGGCCTCGACATGGCCATGCCCGACGGAACGCTCGTCATGGGCCAACAG
GCGTGGGGCCAGCCTCTCCTTGACGCTGTTCGCAACGGAAGCGTGCCCGAGACGAGGCTAGACGACATGGTTACC
AGGATCCTCTCGCCCTGGTTCCTGCTTAACCAAGACTCCATTCTCCCCAACCCCGGGATTGGCAAAATCGACAAC
GTCACGCAGCCCCATCCCATCATTGACGCCCGCGACCCTTCCTCCCGCCCCATTCTCTTCCAAGACGCTGTCCAA
GGCCACGTGCTCGTCAAAAACACAAAATCAACTCTTCCGCTAAACTCCCCGCGCCTCATCTCCCTCTTTGGCTAC
TCTGCAAAGTCTCCCGATCTCTTTGGCCCGTCGTTTGGCTCCGAGGCCGACGGCTGGGCTTCCGGCACCGAGCCA
ATCAACTATGACGAGTTTTTCCAAAATACCTGGCTCATGTCTAAAAATCATACCCGGTCCGTCATTGGCATCAAC
GGCACCATGATTGGCGCCGCGGGCTCGGCTGCTGTGGCGCCTGCTGTTTTTACCGCGCCGTTTGAGTCGCTCAAG
GTGCGCGCTGCACGGGATGACACGGCCGTGTTTTTTGATTTCGTATCGGCAGAGCCTGCTGTTGATCCTGTGAGC
GACGCGTGTATAGTCTTTGGCAATGCCTGGGCGTCGGAGGGCTACGACCGGCCGGCGATTTCAGACGAGTATACG
GATACCCTCATCAACGCTGTAGCGGACCAATGTGAAAAGACAATCGTCGTTTTACACAATGCTGGAATCCGTCTT
GCCGATCCCTTCATCACACATGACAACGTCACGGCTGTCATCTACGCCCACTTGCCCGGCCGTGACAGCGGCGAC
GCCATCGTCTCTCTCCTCTACGGCGAATCCAACCCCTCGGGCAAACTCCCCTATACCGTGGCCAAGAAATCCTCC
GACTACGGCTCCCTCCTCAACCCCGACGACCCCAACAGCACGTTTCCGCAATCCACCTTTGTCGAGGGCATATAC
CTCGACTACAAACACTTTGAAAAAAACAATATATCGCCCCGTTTTGAATTCGGCTTTGGCCTTAGCTACACCTCG
TTTTCCATGTCCAGTCTTGATATCACGTCCCCCGCGTCTCTGCCCGCTTACCCCACTGGCGCAGTCGTCAGCGGC
GGCCAGACCGACTTGTGGGATACAGTGGCAACAGTCAAGCTCGACGTGTGTAATTCAGGCCCCGTGCCTGGCGCC
GAGGTTGTCCAGCTATATGTCTACATGCCGGGCGAGCCGGTCAAGCAGCTGCGGGGGTTTGAAAGGGTGATGCTG
CAGCCTGGCGAGGTGCAGAGCGTCACGTTGGAGTTGATGAGGAGGGACTTGAGTCGGTGGGATACGGTGGCGCAA
AAGTGGAGGCTTGATTGCGGGAGGTATAGAGTGCTTGTGGGAAACAGCAGTTGCAACTTGCCGCTGCAAGGGAGT
GTTGAAGTGTGGCGAGACGAGTGTTAG
Transcript >OphauG2|89
ATGGGCGCCGAGTTTAGGAAAAAAGGCATCAACGTCCATCTCGGCCCCACCATCGGGCCCCTGGGGCGCGTTGTT
CGCGGCGGGAGGAACTGGGAGGGCTTTGCGGCCGATGCGTACCTTGCGGGGGTCATGGGCGGCGCATCGGTAGAG
GGGATGCAGAGCCAGGGCGTGCAATCCTGCGCCAAGCATTACATTGCAAATGAGCAAGAGACGAATCGCATGGTC
TTGGACAAGGGCGAATCCGTGTCGTCGAACCTTGACGACAGGACGATGCATGAAGTCTATCTCTGGCCGTTTCAA
AACGCCGTCAAGGCGGGTGTTGTAAACGTCATGTGTTCATACCAGCGCGTCAACAACTCGTACGCGTGCTCTAAT
AGCAAGATCCTAAACGGGCTGTTGAAAACAGAGCTCGGGTTCCAGGGCTTCGTCGTTACCGATTGGAAGGCAAAC
TTTGCAGGCCCAGATGCTGCTCCGGCGGGCCTCGACATGGCCATGCCCGACGGAACGCTCGTCATGGGCCAACAG
GCGTGGGGCCAGCCTCTCCTTGACGCTGTTCGCAACGGAAGCGTGCCCGAGACGAGGCTAGACGACATGGTTACC
AGGATCCTCTCGCCCTGGTTCCTGCTTAACCAAGACTCCATTCTCCCCAACCCCGGGATTGGCAAAATCGACAAC
GTCACGCAGCCCCATCCCATCATTGACGCCCGCGACCCTTCCTCCCGCCCCATTCTCTTCCAAGACGCTGTCCAA
GGCCACGTGCTCGTCAAAAACACAAAATCAACTCTTCCGCTAAACTCCCCGCGCCTCATCTCCCTCTTTGGCTAC
TCTGCAAAGTCTCCCGATCTCTTTGGCCCGTCGTTTGGCTCCGAGGCCGACGGCTGGGCTTCCGGCACCGAGCCA
ATCAACTATGACGAGTTTTTCCAAAATACCTGGCTCATGTCTAAAAATCATACCCGGTCCGTCATTGGCATCAAC
GGCACCATGATTGGCGCCGCGGGCTCGGCTGCTGTGGCGCCTGCTGTTTTTACCGCGCCGTTTGAGTCGCTCAAG
GTGCGCGCTGCACGGGATGACACGGCCGTGTTTTTTGATTTCGTATCGGCAGAGCCTGCTGTTGATCCTGTGAGC
GACGCGTGTATAGTCTTTGGCAATGCCTGGGCGTCGGAGGGCTACGACCGGCCGGCGATTTCAGACGAGTATACG
GATACCCTCATCAACGCTGTAGCGGACCAATGTGAAAAGACAATCGTCGTTTTACACAATGCTGGAATCCGTCTT
GCCGATCCCTTCATCACACATGACAACGTCACGGCTGTCATCTACGCCCACTTGCCCGGCCGTGACAGCGGCGAC
GCCATCGTCTCTCTCCTCTACGGCGAATCCAACCCCTCGGGCAAACTCCCCTATACCGTGGCCAAGAAATCCTCC
GACTACGGCTCCCTCCTCAACCCCGACGACCCCAACAGCACGTTTCCGCAATCCACCTTTGTCGAGGGCATATAC
CTCGACTACAAACACTTTGAAAAAAACAATATATCGCCCCGTTTTGAATTCGGCTTTGGCCTTAGCTACACCTCG
TTTTCCATGTCCAGTCTTGATATCACGTCCCCCGCGTCTCTGCCCGCTTACCCCACTGGCGCAGTCGTCAGCGGC
GGCCAGACCGACTTGTGGGATACAGTGGCAACAGTCAAGCTCGACGTGTGTAATTCAGGCCCCGTGCCTGGCGCC
GAGGTTGTCCAGCTATATGTCTACATGCCGGGCGAGCCGGTCAAGCAGCTGCGGGGGTTTGAAAGGGTGATGCTG
CAGCCTGGCGAGGTGCAGAGCGTCACGTTGGAGTTGATGAGGAGGGACTTGAGTCGGTGGGATACGGTGGCGCAA
AAGTGGAGGCTTGATTGCGGGAGGTATAGAGTGCTTGTGGGAAACAGCAGTTGCAACTTGCCGCTGCAAGGGAGT
GTTGAAGTGTGGCGAGACGAGTGTTAG
Gene >OphauG2|89
ATGGGCGCCGAGTTTAGGAAAAAAGGCATCAACGTCCATCTCGGCCCCACCATCGGGCCCCTGGGGCGCGTTGTT
CGCGGCGGGAGGAACTGGGAGGGCTTTGCGGCCGATGCGTACCTTGCGGGGGTCATGGGCGGCGCATCGGTAGAG
GGGATGCAGAGCCAGGGCGTGCAATCCTGCGCCAAGGTACGTTTTGATGCAAGCTGTCTTCTTTTCTTTTCTTTG
TTTTCTTTACCTTTCTTCTCTTTTTTTTTTTTTTTTTAAAAAAAAAAGGGTAACAAAAGTGGTTTGATTTCGGAT
AGCATTACATTGCAAATGAGCAAGAGACGAATCGCATGGTCTTGGACAAGGGCGAATCCGTGTCGTCGAACCTTG
ACGACAGGACGATGCATGAAGTCTATCTCTGGTGAGTTTTTACCGCGTTGGTGTAGGAACGTGGAATTGGAGTAA
CTCGTCTTTACAAGGCCGTTTCAAAACGCCGTCAAGGCGGGTGTTGTAAACGTCATGTGTTCATACCAGCGCGTC
AACAACTCGTACGCGTGCTCTAATAGCAAGATCCTAAACGGGCTGTTGAAAACAGAGCTCGGGTTCCAGGTACGT
GTCCAGAACAATATATCCAGAAATATATATATATGTGTGTGTGTTTATTCATACAGCCAAACACCGTGCTAGGGC
TTCGTCGTTACCGATTGGAAGGCAAACTTTGCAGGCCCAGATGCTGCTCCGGCGGGCCTCGACATGGCCATGCCC
GACGGAACGCTCGTCATGGGCCAACAGGCGTGGGGCCAGCCTCTCCTTGACGCTGTTCGCAACGGAAGCGTGCCC
GAGACGAGGCTAGACGACATGGTTACCAGGTTCGTTGTCGACAACTCGTCGAAGCCCGACCCTTGAAAAAATTCG
AGTCAACAAGAAAACACCTAAACCGCCTTGCTAAAATAATCATAGGATCCTCTCGCCCTGGTTCCTGCTTAACCA
AGACTCCATTCTCCCCAACCCCGGGATTGGCAAAATCGACAACGTCACGCAGCCCCATCCCATCATTGACGCCCG
CGACCCTTCCTCCCGCCCCATTCTCTTCCAAGACGCTGTCCAAGGCCACGTGCTCGTCAAAAACACAAAATCAAC
TCTTCCGCTAAACTCCCCGCGCCTCATCTCCCTCTTTGGCTACTCTGCAAAGTCTCCCGATCTCTTTGGCCCGTC
GTTTGGCTCCGAGGCCGACGGCTGGGCTTCCGGCACCGAGCCAATCAACTATGACGAGTTTTTCCAAAATACCTG
GCTCATGTCTAAAAATCATACCCGGTCCGTCATTGGCATCAACGGCACCATGATTGGCGCCGCGGGCTCGGCTGC
TGTGGCGCCTGCTGTTTTTACCGCGCCGTTTGAGTCGCTCAAGGTGCGCGCTGCACGGGATGACACGGCCGTGTT
TTTTGATTTCGTATCGGCAGAGCCTGCTGTTGATCCTGTGAGCGACGCGTGTATAGTCTTTGGCAATGCCTGGGC
GTCGGAGGGCTACGACCGGCCGGCGATTTCAGACGAGTATACGGATACCCTCATCAACGCTGTAGCGGACCAATG
TGAAAAGACAATCGTCGTTTTACACAATGCTGGAATCCGTCTTGCCGATCCCTTCATCACACATGACAACGTCAC
GGCTGTCATCTACGCCCACTTGCCCGGCCGTGACAGCGGCGACGCCATCGTCTCTCTCCTCTACGGCGAATCCAA
CCCCTCGGGCAAACTCCCCTATACCGTGGCCAAGAAATCCTCCGACTACGGCTCCCTCCTCAACCCCGACGACCC
CAACAGCACGTTTCCGCAATCCACCTTTGTCGAGGGCATATACCTCGACTACAAACACTTTGAAAAAAACAATAT
ATCGCCCCGTTTTGAATTCGGCTTTGGCCTTAGCTACACCTCGTTTTCCATGTCCAGTCTTGATATCACGTCCCC
CGCGTCTCTGCCCGCTTACCCCACTGGCGCAGTCGTCAGCGGCGGCCAGACCGACTTGTGGGATACAGTGGCAAC
AGTCAAGCTCGACGTGTGTAATTCAGGCCCCGTGCCTGGCGCCGAGGTTGTCCAGCTATATGTCTACATGCCGGG
CGAGCCGGTCAAGCAGCTGCGGGGGTTTGAAAGGGTGATGCTGCAGCCTGGCGAGGTGCAGAGCGTCACGTTGGA
GTTGATGAGGAGGGACTTGAGTCGGTGGGATACGGTGGCGCAAAAGTGGAGGCTTGATTGCGGGAGGTATAGAGT
GCTTGTGGGAAACAGCAGTTGCAACTTGCCGCTGCAAGGGAGTGTTGAAGTGTGGCGAGACGAGTGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail