Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|862
Gene name
LocationContig_1224:3743..4561
Strand-
Gene length (bp)818
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08657 DASH_Spc34 DASH complex subunit Spc34 3.6E-22 5 58
PF08657 DASH_Spc34 DASH complex subunit Spc34 1.4E-22 72 233

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0042729 DASH complex Yes
GO:0008608 attachment of spindle microtubules to kinetochore Yes
GO:0005876 spindle microtubule Yes
GO:0032991 protein-containing complex No
GO:0022402 cell cycle process No
GO:0140513 nuclear protein-containing complex No
GO:0099081 supramolecular polymer No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0099512 supramolecular fiber No
GO:0099513 polymeric cytoskeletal fiber No
GO:0099080 supramolecular complex No
GO:0009987 cellular process No
GO:0005874 microtubule No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|862
MSLFDVHLEQIASSCQGIDALPFPPPAIFTNALLSNHDITTLIRDTEPHERALFSVPAPQPSEASAQPVSDSNGS
SLRRQTVFNVASGEVTTSTSAASSAPCNPRRHTAVAAVLGGDMHEQLRPATTGRKTDPVDVEILLRGAEKLCGVY
ELPGARERIASLRTRQKNAKSALAYYETKVAEQAEQLAKMNKDCKPHDHQEHQDSVQEYQVWTQDDLNQQEEESR
ALEARKKELQSRLDAMKKDLDGLNSM*
Coding >OphauG2|862
ATGTCTCTGTTTGACGTCCATCTCGAGCAGATTGCCTCGTCATGTCAGGGCATTGACGCTCTTCCATTCCCACCC
CCCGCAATCTTCACCAATGCCCTCCTCTCCAACCACGACATCACCACCCTGATTCGCGACACCGAGCCTCATGAA
CGAGCCCTGTTTTCCGTCCCCGCCCCTCAACCCTCGGAAGCCTCCGCCCAGCCCGTCAGCGATTCCAATGGCTCA
TCGCTCCGTCGCCAAACCGTCTTCAATGTTGCGTCTGGCGAGGTGACGACGTCGACTTCTGCCGCCTCCTCTGCA
CCGTGTAACCCCAGGCGCCACACCGCAGTCGCTGCCGTCCTGGGCGGCGACATGCACGAGCAACTGCGCCCTGCG
ACTACCGGCCGCAAAACGGACCCAGTCGATGTCGAGATTCTGCTCCGCGGCGCCGAGAAGCTCTGTGGCGTCTAT
GAGCTGCCTGGCGCCCGTGAGCGCATCGCCTCTCTCCGAACCAGACAAAAAAATGCCAAGAGTGCACTGGCTTAC
TACGAGACAAAAGTTGCCGAGCAGGCCGAGCAGCTGGCCAAGATGAACAAGGACTGCAAGCCCCATGACCATCAA
GAGCACCAAGATTCCGTCCAAGAATACCAAGTATGGACCCAAGACGACCTGAACCAACAGGAGGAAGAGTCTCGC
GCCCTAGAAGCCCGCAAGAAGGAGTTGCAGTCACGACTAGATGCCATGAAGAAGGATCTCGATGGCCTCAACAGT
ATGTGA
Transcript >OphauG2|862
ATGTCTCTGTTTGACGTCCATCTCGAGCAGATTGCCTCGTCATGTCAGGGCATTGACGCTCTTCCATTCCCACCC
CCCGCAATCTTCACCAATGCCCTCCTCTCCAACCACGACATCACCACCCTGATTCGCGACACCGAGCCTCATGAA
CGAGCCCTGTTTTCCGTCCCCGCCCCTCAACCCTCGGAAGCCTCCGCCCAGCCCGTCAGCGATTCCAATGGCTCA
TCGCTCCGTCGCCAAACCGTCTTCAATGTTGCGTCTGGCGAGGTGACGACGTCGACTTCTGCCGCCTCCTCTGCA
CCGTGTAACCCCAGGCGCCACACCGCAGTCGCTGCCGTCCTGGGCGGCGACATGCACGAGCAACTGCGCCCTGCG
ACTACCGGCCGCAAAACGGACCCAGTCGATGTCGAGATTCTGCTCCGCGGCGCCGAGAAGCTCTGTGGCGTCTAT
GAGCTGCCTGGCGCCCGTGAGCGCATCGCCTCTCTCCGAACCAGACAAAAAAATGCCAAGAGTGCACTGGCTTAC
TACGAGACAAAAGTTGCCGAGCAGGCCGAGCAGCTGGCCAAGATGAACAAGGACTGCAAGCCCCATGACCATCAA
GAGCACCAAGATTCCGTCCAAGAATACCAAGTATGGACCCAAGACGACCTGAACCAACAGGAGGAAGAGTCTCGC
GCCCTAGAAGCCCGCAAGAAGGAGTTGCAGTCACGACTAGATGCCATGAAGAAGGATCTCGATGGCCTCAACAGT
ATGTGA
Gene >OphauG2|862
ATGTCTCTGTTTGACGTCCATCTCGAGCAGATTGCCTCGTCATGTCAGGGCATTGACGCTCTTCCGTATGCGCAT
ACACCTTGTCGTCCTGTCTGTCAACAGCCAGCCATTGACGCATTTGACGCAGATTCCCACCCCCCGCAATCTTCA
CCAATGCCCTCCTCTCCAACCACGACATCACCACCCTGATTCGCGACACCGAGCCTCATGAACGAGCCCTGTTTT
CCGTCCCCGCCCCTCAACCCTCGGAAGCCTCCGCCCAGCCCGTCAGCGATTCCAATGGCTCATCGCTCCGTCGCC
AAACCGTCTTCAATGTTGCGTCTGGCGAGGTGACGACGTCGACTTCTGCCGCCTCCTCTGCACCGTGTAACCCCA
GGCGCCACACCGCAGTCGCTGCCGTCCTGGGCGGCGACATGCACGAGCAACTGCGCCCTGCGACTACCGGCCGCA
AAACGGACCCAGTCGATGTCGAGATTCTGCTCCGCGGCGCCGAGAAGCTCTGTGGCGTCTATGAGCTGCCTGGCG
CCCGTGAGCGCATCGCCTCTCTCCGAACCAGACAAAAAAATGCCAAGAGTGCACTGGCTTACTACGAGACAAAAG
TTGCCGAGCAGGCCGAGCAGCTGGCCAAGATGAACAAGGACTGCAAGCCCCATGACCATCAAGAGCACCAAGATT
CCGTCCAAGAATACCAAGTATGGACCCAAGACGACCTGAACCAACAGGAGGAAGAGTCTCGCGCCCTAGAAGCCC
GCAAGAAGGAGTTGCAGTCACGACTAGATGCCATGAAGAAGGATCTCGATGGCCTCAACAGTATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail