Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|860
Gene name
LocationContig_1224:551..2011
Strand-
Gene length (bp)1460
Transcript length (bp)1266
Coding sequence length (bp)1266
Protein length (aa) 422

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.5E-44 202 334
PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain 1.4E-10 89 144
PF07728 AAA_5 AAA domain (dynein-related subfamily) 3.0E-08 201 323
PF07724 AAA_2 AAA domain (Cdc48 subfamily) 1.5E-07 202 295
PF05673 DUF815 Protein of unknown function (DUF815) 4.6E-06 162 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78578|PRS6B_ASPNG 26S protease regulatory subunit 6B homolog OS=Aspergillus niger GN=tbpA PE=3 SV=1 1 421 0.0E+00
sp|P33298|PRS6B_YEAST 26S protease regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT3 PE=1 SV=2 37 421 0.0E+00
sp|O74894|PRS6B_SCHPO 26S protease regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt3 PE=3 SV=1 39 421 0.0E+00
sp|P46507|PRS6B_MANSE 26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1 21 421 0.0E+00
sp|Q4R7L3|PRS6B_MACFA 26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1 34 421 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78578|PRS6B_ASPNG 26S protease regulatory subunit 6B homolog OS=Aspergillus niger GN=tbpA PE=3 SV=1 1 421 0.0E+00
sp|P33298|PRS6B_YEAST 26S protease regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT3 PE=1 SV=2 37 421 0.0E+00
sp|O74894|PRS6B_SCHPO 26S protease regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt3 PE=3 SV=1 39 421 0.0E+00
sp|P46507|PRS6B_MANSE 26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1 21 421 0.0E+00
sp|Q4R7L3|PRS6B_MACFA 26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1 34 421 0.0E+00
sp|P43686|PRS6B_HUMAN 26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2 34 421 0.0E+00
sp|Q3T030|PRS6B_BOVIN 26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1 34 421 0.0E+00
sp|Q63570|PRS6B_RAT 26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1 34 421 0.0E+00
sp|P54775|PRS6B_MOUSE 26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=2 34 421 0.0E+00
sp|Q9SEI4|PRS6B_ARATH 26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1 36 421 0.0E+00
sp|P85200|PRS6B_HELAN 26S protease regulatory subunit 6B homolog OS=Helianthus annuus PE=1 SV=1 36 421 0.0E+00
sp|P54778|PRS6B_SOLTU 26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1 29 421 0.0E+00
sp|P46502|PRS6B_CAEEL Probable 26S protease regulatory subunit 6B OS=Caenorhabditis elegans GN=rpt-3 PE=3 SV=1 7 421 0.0E+00
sp|P34123|PRS6B_DICDI 26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1 38 420 0.0E+00
sp|Q8SQI9|PRS6B_ENCCU 26S protease regulatory subunit 6B homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1970 PE=1 SV=1 38 417 2.0E-180
sp|P48601|PRS4_DROME 26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Rpt2 PE=1 SV=2 43 406 3.0E-127
sp|Q9SL67|PRS4B_ARATH 26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=1 SV=1 44 403 2.0E-124
sp|P62193|PRS4_RAT 26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1 43 403 2.0E-124
sp|P62192|PRS4_MOUSE 26S protease regulatory subunit 4 OS=Mus musculus GN=Psmc1 PE=1 SV=1 43 403 2.0E-124
sp|P62191|PRS4_HUMAN 26S protease regulatory subunit 4 OS=Homo sapiens GN=PSMC1 PE=1 SV=1 43 403 2.0E-124
sp|Q90732|PRS4_CHICK 26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1 43 403 4.0E-124
sp|Q9SZD4|PRS4A_ARATH 26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana GN=RPT2A PE=1 SV=1 44 403 5.0E-124
sp|P46466|PRS4_ORYSJ 26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2 44 403 3.0E-123
sp|O16368|PRS4_CAEEL Probable 26S protease regulatory subunit 4 OS=Caenorhabditis elegans GN=rpt-2 PE=3 SV=1 44 403 6.0E-121
sp|P36612|PRS4_SCHPO 26S protease regulatory subunit 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mts2 PE=2 SV=1 44 415 1.0E-120
sp|Q55BV5|PRS4_DICDI 26S protease regulatory subunit 4 homolog OS=Dictyostelium discoideum GN=psmC1 PE=1 SV=1 33 403 7.0E-120
sp|P40327|PRS4_YEAST 26S protease regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT2 PE=1 SV=3 44 420 5.0E-117
sp|O28303|PAN_ARCFU Proteasome-activating nucleotidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pan PE=1 SV=1 40 411 2.0E-113
sp|C5A6P8|PAN_THEGJ Proteasome-activating nucleotidase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pan PE=3 SV=1 29 400 6.0E-112
sp|Q5JHS5|PAN_THEKO Proteasome-activating nucleotidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pan PE=3 SV=1 36 400 1.0E-111
sp|O57940|PAN_PYRHO Proteasome-activating nucleotidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pan PE=3 SV=1 39 417 4.0E-110
sp|B6YXR2|PAN_THEON Proteasome-activating nucleotidase OS=Thermococcus onnurineus (strain NA1) GN=pan PE=3 SV=1 34 400 9.0E-110
sp|O26824|PAN_METTH Proteasome-activating nucleotidase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pan PE=3 SV=1 43 417 2.0E-109
sp|Q8U4H3|PAN_PYRFU Proteasome-activating nucleotidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pan PE=1 SV=1 39 417 2.0E-108
sp|Q8TX03|PAN_METKA Proteasome-activating nucleotidase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pan PE=3 SV=1 45 421 5.0E-108
sp|Q9V287|PAN_PYRAB Proteasome-activating nucleotidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pan PE=3 SV=2 39 417 5.0E-108
sp|Q0W257|PAN_METAR Proteasome-activating nucleotidase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pan PE=3 SV=1 46 416 7.0E-106
sp|Q8SRH0|PRS4_ENCCU 26S protease regulatory subunit 4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT2 PE=1 SV=1 79 400 2.0E-105
sp|A6VHR1|PAN_METM7 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1 46 419 2.0E-103
sp|Q9YAC7|PAN_AERPE Proteasome-activating nucleotidase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pan PE=3 SV=1 64 400 4.0E-103
sp|Q6LWR0|PAN_METMP Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain S2 / LL) GN=pan PE=3 SV=1 44 419 4.0E-103
sp|Q58576|PAN_METJA Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pan PE=1 SV=1 78 403 4.0E-103
sp|A9A916|PAN_METM6 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1 44 419 4.0E-103
sp|Q8PY58|PAN_METMA Proteasome-activating nucleotidase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pan PE=3 SV=1 47 392 7.0E-103
sp|A6UQT3|PAN_METVS Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1 42 416 1.0E-102
sp|D4GUJ7|PAN1_HALVD Proteasome-activating nucleotidase 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan1 PE=1 SV=2 36 416 2.0E-102
sp|A3CV35|PAN_METMJ Proteasome-activating nucleotidase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pan PE=3 SV=1 46 392 2.0E-102
sp|Q8TI88|PAN_METAC Proteasome-activating nucleotidase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pan PE=3 SV=2 47 403 7.0E-102
sp|A4G0S4|PAN_METM5 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1 44 419 1.0E-101
sp|Q8SQK0|PRS8_ENCCU 26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT6 PE=1 SV=2 61 415 7.0E-101
sp|C3N7K8|PAN_SULIY Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pan PE=3 SV=1 50 405 4.0E-100
sp|C3MY47|PAN_SULIM Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pan PE=3 SV=1 50 405 4.0E-100
sp|C3MRF1|PAN_SULIL Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pan PE=3 SV=1 50 405 4.0E-100
sp|C4KIR6|PAN_SULIK Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pan PE=3 SV=1 50 405 4.0E-100
sp|C3MZI6|PAN_SULIA Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.27) GN=pan PE=3 SV=1 50 405 4.0E-100
sp|Q2FQ56|PAN_METHJ Proteasome-activating nucleotidase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pan PE=3 SV=1 45 400 2.0E-99
sp|C3NFW6|PAN_SULIN Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pan PE=3 SV=1 50 405 2.0E-99
sp|Q980M1|PAN_SULSO Proteasome-activating nucleotidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pan PE=3 SV=1 50 405 5.0E-99
sp|B8GGN4|PAN_METPE Proteasome-activating nucleotidase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pan PE=3 SV=1 46 403 6.0E-99
sp|Q94BQ2|PRS8B_ARATH 26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=1 SV=1 44 415 6.0E-98
sp|Q9C5U3|PRS8A_ARATH 26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=1 SV=1 43 415 5.0E-97
sp|Q975U2|PAN_SULTO Proteasome-activating nucleotidase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pan PE=3 SV=2 54 400 9.0E-97
sp|O18413|PRS8_DROME 26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Rpt6 PE=1 SV=2 27 415 1.0E-96
sp|P54814|PRS8_MANSE 26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1 76 415 1.0E-96
sp|P46465|PRS6A_ORYSJ 26S protease regulatory subunit 6A homolog OS=Oryza sativa subsp. japonica GN=TBP1 PE=2 SV=2 64 403 3.0E-96
sp|Q9MAK9|PS10B_ARATH 26S protease regulatory subunit S10B homolog B OS=Arabidopsis thaliana GN=RPT4B PE=1 SV=1 62 403 5.0E-96
sp|Q25544|PRS8_NAEFO 26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1 39 421 1.0E-95
sp|O17071|PRS10_CAEEL Probable 26S protease regulatory subunit 10B OS=Caenorhabditis elegans GN=rpt-4 PE=1 SV=2 44 419 3.0E-95
sp|A7I8B8|PAN_METB6 Proteasome-activating nucleotidase OS=Methanoregula boonei (strain 6A8) GN=pan PE=3 SV=1 46 403 9.0E-95
sp|Q41365|PRS7_SPIOL 26S protease regulatory subunit 7 OS=Spinacia oleracea GN=RPT1 PE=2 SV=1 86 410 9.0E-95
sp|Q9SSB5|PRS7A_ARATH 26S protease regulatory subunit 7 homolog A OS=Arabidopsis thaliana GN=RPT1A PE=1 SV=1 86 410 1.0E-94
sp|O64982|PRS7_PRUPE 26S protease regulatory subunit 7 OS=Prunus persica GN=RPT1 PE=2 SV=1 86 410 1.0E-94
sp|Q9FXT9|PRS7_ORYSJ 26S protease regulatory subunit 7 OS=Oryza sativa subsp. japonica GN=RPT1A PE=2 SV=1 86 410 1.0E-94
sp|Q8SR13|PRS6A_ENCCU 26S protease regulatory subunit 6A OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT5 PE=1 SV=1 44 403 2.0E-94
sp|Q2KIW6|PRS10_BOVIN 26S protease regulatory subunit 10B OS=Bos taurus GN=PSMC6 PE=2 SV=1 61 419 2.0E-94
sp|Q9SEI3|PS10A_ARATH 26S protease regulatory subunit 10B homolog A OS=Arabidopsis thaliana GN=RPT4A PE=1 SV=1 62 403 3.0E-94
sp|P62334|PRS10_MOUSE 26S protease regulatory subunit 10B OS=Mus musculus GN=Psmc6 PE=1 SV=1 61 419 4.0E-94
sp|P62335|PRS10_ICTTR 26S protease regulatory subunit 10B OS=Ictidomys tridecemlineatus GN=PSMC6 PE=2 SV=1 61 419 4.0E-94
sp|P62333|PRS10_HUMAN 26S protease regulatory subunit 10B OS=Homo sapiens GN=PSMC6 PE=1 SV=1 61 419 4.0E-94
sp|Q01939|PRS8_YEAST 26S protease regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT6 PE=1 SV=4 43 403 6.0E-94
sp|P54776|PRS6A_SOLLC 26S protease regulatory subunit 6A homolog OS=Solanum lycopersicum GN=TBP1 PE=2 SV=1 64 403 8.0E-94
sp|O74445|PRS10_SCHPO Probable 26S protease subunit rpt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt4 PE=3 SV=2 65 403 1.0E-93
sp|P62198|PRS8_RAT 26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1 89 415 1.0E-93
sp|P62197|PRS8_PIG 26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1 89 415 1.0E-93
sp|P62196|PRS8_MOUSE 26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1 89 415 1.0E-93
sp|P62195|PRS8_HUMAN 26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1 89 415 1.0E-93
sp|P62194|PRS8_BOVIN 26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1 89 415 1.0E-93
sp|P17980|PRS6A_HUMAN 26S protease regulatory subunit 6A OS=Homo sapiens GN=PSMC3 PE=1 SV=3 61 399 1.0E-93
sp|O88685|PRS6A_MOUSE 26S protease regulatory subunit 6A OS=Mus musculus GN=Psmc3 PE=1 SV=2 61 399 2.0E-93
sp|Q63569|PRS6A_RAT 26S protease regulatory subunit 6A OS=Rattus norvegicus GN=Psmc3 PE=2 SV=1 61 399 2.0E-93
sp|O42586|PR6AB_XENLA 26S protease regulatory subunit 6A-B OS=Xenopus laevis GN=psmc3-b PE=2 SV=1 61 399 2.0E-93
sp|Q86JA1|PRS7_DICDI 26S protease regulatory subunit 7 OS=Dictyostelium discoideum GN=psmC2 PE=1 SV=1 109 409 3.0E-93
sp|Q54PN7|PRS6A_DICDI 26S protease regulatory subunit 6A homolog OS=Dictyostelium discoideum GN=psmC3 PE=1 SV=1 56 400 4.0E-93
sp|O23894|PRS6A_BRACM 26S protease regulatory subunit 6A homolog OS=Brassica campestris GN=TBP1 PE=2 SV=1 64 403 5.0E-93
sp|Q9SEI2|PS6AA_ARATH 26S protease regulatory subunit 6A homolog A OS=Arabidopsis thaliana GN=RPT5A PE=1 SV=1 64 403 5.0E-93
sp|O04019|PS6AB_ARATH 26S protease regulatory subunit 6A homolog B OS=Arabidopsis thaliana GN=RPT5B PE=1 SV=3 67 403 3.0E-91
sp|P41836|PRS8_SCHPO 26S protease regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=let1 PE=3 SV=1 76 421 9.0E-91
sp|Q9HRW6|PAN1_HALSA Proteasome-activating nucleotidase 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan1 PE=3 SV=3 44 403 1.0E-90
sp|P53549|PRS10_YEAST 26S protease subunit RPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT4 PE=1 SV=4 66 403 1.0E-90
sp|P46470|PRS8_XENLA 26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2 89 415 2.0E-90
sp|P34124|PRS8_DICDI 26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2 76 415 2.0E-90
sp|Q9SSB4|PRS7B_ARATH 26S protease regulatory subunit 7 homolog B OS=Arabidopsis thaliana GN=RPT1B PE=1 SV=2 86 410 4.0E-90
sp|P46471|PRS7_MOUSE 26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5 86 409 3.0E-89
sp|Q4R4R0|PRS7_MACFA 26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3 86 409 3.0E-89
sp|P35998|PRS7_HUMAN 26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3 86 409 3.0E-89
sp|Q5E9F9|PRS7_BOVIN 26S protease regulatory subunit 7 OS=Bos taurus GN=PSMC2 PE=2 SV=3 86 409 3.0E-89
sp|P46472|PRS7_XENLA 26S protease regulatory subunit 7 OS=Xenopus laevis GN=psmc2 PE=2 SV=1 102 409 4.0E-89
sp|Q18787|PRS7_CAEEL 26S protease regulatory subunit 7 OS=Caenorhabditis elegans GN=rpt-1 PE=1 SV=1 109 410 1.0E-88
sp|Q54PJ1|PRS10_DICDI 26S protease regulatory subunit 10B OS=Dictyostelium discoideum GN=psmC6 PE=1 SV=1 66 421 2.0E-88
sp|O42587|PR6AA_XENLA 26S protease regulatory subunit 6A-A OS=Xenopus laevis GN=psmc3-a PE=2 SV=1 61 389 3.0E-88
sp|Q5R8D7|PRS7_PONAB 26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3 102 409 4.0E-88
sp|Q5UT56|PAN2_HALVD Proteasome-activating nucleotidase 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan2 PE=2 SV=1 82 421 5.0E-88
sp|Q63347|PRS7_RAT 26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3 86 409 5.0E-88
sp|Q9HNP9|PAN2_HALSA Proteasome-activating nucleotidase 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan2 PE=3 SV=1 74 408 6.0E-88
sp|P33297|PRS6A_YEAST 26S protease regulatory subunit 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT5 PE=1 SV=3 38 405 2.0E-87
sp|O42931|PRS7_SCHPO 26S protease regulatory subunit 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt1 PE=1 SV=2 94 411 1.0E-86
sp|O14126|PRS6A_SCHPO 26S protease regulatory subunit 6A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tbp1 PE=3 SV=1 47 389 3.0E-85
sp|P33299|PRS7_YEAST 26S protease regulatory subunit 7 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT1 PE=1 SV=1 143 410 6.0E-85
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 158 389 1.0E-61
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 160 389 5.0E-61
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 160 400 6.0E-61
sp|D1C4U5|FTSH3_SPHTD ATP-dependent zinc metalloprotease FtsH 3 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH3 PE=3 SV=1 156 410 2.0E-60
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 160 400 2.0E-59
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 160 389 8.0E-59
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 158 389 8.0E-59
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 158 403 3.0E-58
sp|Q67JH0|FTSH3_SYMTH ATP-dependent zinc metalloprotease FtsH 3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH3 PE=3 SV=1 150 416 2.0E-57
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 162 393 2.0E-57
sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 145 389 5.0E-57
sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 158 421 2.0E-56
sp|O83746|FTSH_TREPA ATP-dependent zinc metalloprotease FtsH OS=Treponema pallidum (strain Nichols) GN=ftsH PE=3 SV=1 164 410 3.0E-56
sp|C8W731|FTSH_ATOPD ATP-dependent zinc metalloprotease FtsH OS=Atopobium parvulum (strain ATCC 33793 / DSM 20469 / JCM 10300 / VPI 0546) GN=ftsH PE=3 SV=1 158 415 9.0E-56
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 158 401 1.0E-54
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 158 401 1.0E-54
sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 158 421 4.0E-54
sp|B2UMY1|FTSH_AKKM8 ATP-dependent zinc metalloprotease FtsH OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ftsH PE=3 SV=1 150 403 6.0E-54
sp|C7M0M0|FTSH_ACIFD ATP-dependent zinc metalloprotease FtsH OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=ftsH PE=3 SV=1 158 410 9.0E-54
sp|D1C1U7|FTSH1_SPHTD ATP-dependent zinc metalloprotease FtsH 1 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH1 PE=3 SV=1 150 410 1.0E-53
sp|D1C2C6|FTSH2_SPHTD ATP-dependent zinc metalloprotease FtsH 2 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH2 PE=3 SV=1 162 410 1.0E-53
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 158 401 2.0E-53
sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 158 402 2.0E-53
sp|B9L3S8|FTSH2_THERP ATP-dependent zinc metalloprotease FtsH 2 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH2 PE=3 SV=1 158 411 2.0E-53
sp|D1C8C0|FTSH4_SPHTD ATP-dependent zinc metalloprotease FtsH 4 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsh4 PE=3 SV=1 158 411 5.0E-53
sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 162 408 6.0E-53
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 158 389 1.0E-52
sp|C7MC16|FTSH_BRAFD ATP-dependent zinc metalloprotease FtsH OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=ftsH PE=3 SV=1 150 403 1.0E-52
sp|A1A0U4|ARC_BIFAA AAA ATPase forming ring-shaped complexes OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=arc PE=3 SV=1 94 365 1.0E-52
sp|Q55700|FTSH2_SYNY3 ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH2 PE=1 SV=1 157 410 1.0E-52
sp|B7J0N5|FTSH_BORBZ ATP-dependent zinc metalloprotease FtsH OS=Borrelia burgdorferi (strain ZS7) GN=ftsH PE=3 SV=1 159 403 1.0E-52
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 161 408 2.0E-52
sp|D0MGU8|FTSH_RHOM4 ATP-dependent zinc metalloprotease FtsH OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=ftsH PE=3 SV=1 162 416 2.0E-52
sp|B3DY14|FTSH2_METI4 ATP-dependent zinc metalloprotease FtsH 2 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH2 PE=3 SV=1 150 403 3.0E-52
sp|C0ZPK5|FTSH_RHOE4 ATP-dependent zinc metalloprotease FtsH OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ftsH PE=3 SV=1 160 410 3.0E-52
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 158 389 4.0E-52
sp|B1ZMG6|FTSH_OPITP ATP-dependent zinc metalloprotease FtsH OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ftsH PE=3 SV=1 162 403 4.0E-52
sp|Q6M2F0|FTSH_CORGL ATP-dependent zinc metalloprotease FtsH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ftsH PE=3 SV=1 160 410 4.0E-52
sp|B8G4Q6|FTSH_CHLAD ATP-dependent zinc metalloprotease FtsH OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ftsH PE=3 SV=1 150 403 5.0E-52
sp|P9WQN3|FTSH_MYCTU ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsH PE=1 SV=1 160 410 7.0E-52
sp|A5U8T5|FTSH_MYCTA ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsH PE=3 SV=1 160 410 7.0E-52
sp|P0A4V9|FTSH_MYCBO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ftsH PE=3 SV=1 160 410 7.0E-52
sp|Q67T82|FTSH2_SYMTH ATP-dependent zinc metalloprotease FtsH 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH2 PE=3 SV=1 147 410 7.0E-52
sp|B4U7U4|FTSH_HYDS0 ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1 157 410 7.0E-52
sp|P9WQN2|FTSH_MYCTO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ftsH PE=3 SV=1 160 410 8.0E-52
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 161 408 9.0E-52
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 158 414 1.0E-51
sp|P73179|FTSH1_SYNY3 ATP-dependent zinc metalloprotease FtsH 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH1 PE=2 SV=1 150 410 1.0E-51
sp|Q9TJ83|FTSH_CYAME ATP-dependent zinc metalloprotease FtsH OS=Cyanidioschyzon merolae GN=ftsH PE=3 SV=1 159 410 1.0E-51
sp|D3F124|FTSH1_CONWI ATP-dependent zinc metalloprotease FtsH 1 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH1 PE=3 SV=1 158 410 1.0E-51
sp|B0K5A3|FTSH1_THEPX ATP-dependent zinc metalloprotease FtsH 1 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH1 PE=3 SV=1 150 410 1.0E-51
sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 161 402 1.0E-51
sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 161 402 1.0E-51
sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 161 402 1.0E-51
sp|Q655S1|FTSH2_ORYSJ ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1 162 410 1.0E-51
sp|B3R057|FTSH1_PHYMT ATP-dependent zinc metalloprotease FtsH 1 OS=Phytoplasma mali (strain AT) GN=ftsH1 PE=3 SV=1 149 418 1.0E-51
sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 161 402 2.0E-51
sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 161 402 2.0E-51
sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 161 402 2.0E-51
sp|P49825|FTSH_ODOSI ATP-dependent zinc metalloprotease FtsH OS=Odontella sinensis GN=ftsH PE=3 SV=1 157 410 2.0E-51
sp|P72991|FTSH3_SYNY3 ATP-dependent zinc metalloprotease FtsH 3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH3 PE=1 SV=1 103 416 2.0E-51
sp|C1F8X6|FTSH_ACIC5 ATP-dependent zinc metalloprotease FtsH OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ftsH PE=3 SV=1 150 410 2.0E-51
sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 161 402 3.0E-51
sp|C7N914|FTSH_LEPBD ATP-dependent zinc metalloprotease FtsH OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) GN=ftsH PE=3 SV=1 157 416 3.0E-51
sp|Q9CD58|FTSH_MYCLE ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium leprae (strain TN) GN=ftsH PE=3 SV=1 160 410 3.0E-51
sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 161 402 3.0E-51
sp|O22993|FTSI1_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic OS=Arabidopsis thaliana GN=FTSHI1 PE=1 SV=1 157 403 3.0E-51
sp|B0K657|FTSH2_THEPX ATP-dependent zinc metalloprotease FtsH 2 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH2 PE=3 SV=1 159 415 3.0E-51
sp|Q2JNP0|FTSH_SYNJB ATP-dependent zinc metalloprotease FtsH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ftsH PE=3 SV=1 159 410 3.0E-51
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 158 389 3.0E-51
sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 158 389 4.0E-51
sp|B9KXV3|FTSH1_THERP ATP-dependent zinc metalloprotease FtsH 1 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH1 PE=3 SV=1 159 410 4.0E-51
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 158 389 4.0E-51
sp|D4HA34|FTSH_PROAS ATP-dependent zinc metalloprotease FtsH OS=Propionibacterium acnes (strain SK137) GN=ftsH PE=3 SV=1 150 410 5.0E-51
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 161 408 5.0E-51
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 118 401 6.0E-51
sp|A6QBN8|FTSH_SULNB ATP-dependent zinc metalloprotease FtsH OS=Sulfurovum sp. (strain NBC37-1) GN=ftsH PE=3 SV=1 158 416 7.0E-51
sp|O80860|FTSH2_ARATH ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1 144 410 9.0E-51
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 162 389 1.0E-50
sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 158 389 1.0E-50
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 162 402 1.0E-50
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 161 402 1.0E-50
sp|Q89AF2|FTSH_BUCBP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ftsH PE=3 SV=1 157 411 1.0E-50
sp|B8J992|FTSH_ANAD2 ATP-dependent zinc metalloprotease FtsH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ftsH PE=3 SV=1 159 410 1.0E-50
sp|B2UE66|FTSH_RALPJ ATP-dependent zinc metalloprotease FtsH OS=Ralstonia pickettii (strain 12J) GN=ftsH PE=3 SV=1 162 416 1.0E-50
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 161 402 2.0E-50
sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 129 389 2.0E-50
sp|Q1XDF9|FTSH_PYRYE ATP-dependent zinc metalloprotease FtsH OS=Pyropia yezoensis GN=ftsH PE=3 SV=1 150 410 2.0E-50
sp|Q9SD67|FTSH7_ARATH ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Arabidopsis thaliana GN=FTSH7 PE=2 SV=1 162 410 2.0E-50
sp|Q6NH92|ARC_CORDI AAA ATPase forming ring-shaped complexes OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=arc PE=3 SV=1 89 365 2.0E-50
sp|D1J722|FTSH_ECTSI ATP-dependent zinc metalloprotease FtsH OS=Ectocarpus siliculosus GN=ftsH PE=3 SV=1 152 391 2.0E-50
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 161 402 3.0E-50
sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 158 397 4.0E-50
sp|C6V4R9|FTSH_NEORI ATP-dependent zinc metalloprotease FtsH OS=Neorickettsia risticii (strain Illinois) GN=ftsH PE=3 SV=1 150 403 4.0E-50
sp|D2Q9C6|ARC_BIFDB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium dentium (strain ATCC 27534 / DSM 20436 / JCM 1195 / Bd1) GN=arc PE=3 SV=1 94 357 4.0E-50
sp|P37476|FTSH_BACSU ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) GN=ftsH PE=1 SV=1 150 410 5.0E-50
sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 161 402 6.0E-50
sp|Q1LLA9|FTSH_CUPMC ATP-dependent zinc metalloprotease FtsH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ftsH PE=3 SV=1 162 403 6.0E-50
sp|Q10ZF7|FTSH_TRIEI ATP-dependent zinc metalloprotease FtsH OS=Trichodesmium erythraeum (strain IMS101) GN=ftsH PE=3 SV=1 157 403 6.0E-50
sp|D5D8E3|FTSH_SULMD ATP-dependent zinc metalloprotease FtsH OS=Sulcia muelleri (strain DMIN) GN=ftsH PE=3 SV=1 161 415 6.0E-50
sp|Q3A579|FTSH_PELCD ATP-dependent zinc metalloprotease FtsH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ftsH PE=3 SV=1 150 411 9.0E-50
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 161 402 1.0E-49
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 118 401 1.0E-49
sp|Q4L3G8|FTSH_STAHJ ATP-dependent zinc metalloprotease FtsH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ftsH PE=3 SV=1 150 410 1.0E-49
sp|Q1AV13|FTSH_RUBXD ATP-dependent zinc metalloprotease FtsH OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ftsH PE=3 SV=1 158 410 1.0E-49
sp|Q8W585|FTSH8_ARATH ATP-dependent zinc metalloprotease FTSH 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1 162 410 1.0E-49
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 160 388 1.0E-49
sp|B1GZK7|FTSH_UNCTG ATP-dependent zinc metalloprotease FtsH OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ftsH PE=3 SV=1 154 403 1.0E-49
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 161 389 1.0E-49
sp|B8H444|FTSH_CAUCN ATP-dependent zinc metalloprotease FtsH OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ftsH PE=2 SV=1 150 410 2.0E-49
sp|Q8K9G8|FTSH_BUCAP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ftsH PE=3 SV=1 150 411 2.0E-49
sp|Q8X9L0|FTSH_ECO57 ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli O157:H7 GN=ftsH PE=3 SV=1 163 403 2.0E-49
sp|P0AAI4|FTSH_SHIFL ATP-dependent zinc metalloprotease FtsH OS=Shigella flexneri GN=ftsH PE=3 SV=1 163 403 2.0E-49
sp|P0AAI3|FTSH_ECOLI ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) GN=ftsH PE=1 SV=1 163 403 2.0E-49
sp|Q0TTK8|FTSH_CLOP1 ATP-dependent zinc metalloprotease FtsH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ftsH PE=3 SV=1 152 410 2.0E-49
sp|P51327|FTSH_PORPU ATP-dependent zinc metalloprotease FtsH OS=Porphyra purpurea GN=ftsH PE=3 SV=1 150 410 2.0E-49
sp|A8ZNZ4|FTSH_ACAM1 ATP-dependent zinc metalloprotease FtsH OS=Acaryochloris marina (strain MBIC 11017) GN=ftsH PE=3 SV=1 162 410 3.0E-49
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 125 414 3.0E-49
sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 158 383 4.0E-49
sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 158 383 4.0E-49
sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 158 383 4.0E-49
sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 158 383 4.0E-49
sp|A6LD25|FTSH_PARD8 ATP-dependent zinc metalloprotease FtsH OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ftsH PE=3 SV=1 153 410 4.0E-49
sp|P94304|FTSH_BACPE ATP-dependent zinc metalloprotease FtsH OS=Bacillus pseudofirmus (strain OF4) GN=ftsH PE=3 SV=2 150 410 4.0E-49
sp|Q3B6R3|FTSH_CHLL7 ATP-dependent zinc metalloprotease FtsH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ftsH PE=3 SV=1 157 416 4.0E-49
sp|A0PXM8|FTSH_CLONN ATP-dependent zinc metalloprotease FtsH OS=Clostridium novyi (strain NT) GN=ftsH PE=3 SV=1 150 410 5.0E-49
sp|Q9FIM2|FTSH9_ARATH ATP-dependent zinc metalloprotease FTSH 9, chloroplastic OS=Arabidopsis thaliana GN=FTSH9 PE=2 SV=1 162 410 5.0E-49
sp|P46469|FTSH_LACLA ATP-dependent zinc metalloprotease FtsH OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ftsH PE=3 SV=1 162 410 5.0E-49
sp|B3R0R7|FTSH3_PHYMT ATP-dependent zinc metalloprotease FtsH 3 OS=Phytoplasma mali (strain AT) GN=ftsH3 PE=3 SV=1 130 418 8.0E-49
sp|O19922|FTSH_CYACA ATP-dependent zinc metalloprotease FtsH OS=Cyanidium caldarium GN=ftsH PE=3 SV=1 152 410 8.0E-49
sp|Q04Q03|FTSH_LEPBJ ATP-dependent zinc metalloprotease FtsH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ftsH PE=3 SV=1 150 403 8.0E-49
sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2 161 410 9.0E-49
sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 158 383 1.0E-48
sp|P47695|FTSH_MYCGE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ftsH PE=3 SV=1 159 410 1.0E-48
sp|P57462|FTSH_BUCAI ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ftsH PE=3 SV=2 150 411 1.0E-48
sp|A0L4S0|FTSH_MAGMM ATP-dependent zinc metalloprotease FtsH OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ftsH PE=3 SV=1 150 410 1.0E-48
sp|O78516|FTSH_GUITH ATP-dependent zinc metalloprotease FtsH OS=Guillardia theta GN=ftsH PE=3 SV=1 157 410 1.0E-48
sp|P75120|FTSH_MYCPN ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ftsH PE=3 SV=1 159 410 2.0E-48
sp|D5HA94|FTSH2_SALRM ATP-dependent zinc metalloprotease FtsH 2 OS=Salinibacter ruber (strain M8) GN=ftsH2 PE=3 SV=1 158 403 2.0E-48
sp|D3FA80|FTSH2_CONWI ATP-dependent zinc metalloprotease FtsH 2 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH2 PE=3 SV=1 162 410 2.0E-48
sp|Q6F0E5|FTSH_MESFL ATP-dependent zinc metalloprotease FtsH OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ftsH PE=3 SV=1 158 410 2.0E-48
sp|Q7UUZ7|FTSH1_RHOBA ATP-dependent zinc metalloprotease FtsH 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH1 PE=3 SV=1 162 403 3.0E-48
sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 161 402 3.0E-48
sp|Q8YMZ8|FTSH_NOSS1 ATP-dependent zinc metalloprotease FtsH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsH PE=3 SV=1 157 410 3.0E-48
sp|A0LR74|FTSH_ACIC1 ATP-dependent zinc metalloprotease FtsH OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ftsH PE=3 SV=1 158 382 3.0E-48
sp|A1AT11|FTSH_PELPD ATP-dependent zinc metalloprotease FtsH OS=Pelobacter propionicus (strain DSM 2379) GN=ftsH PE=3 SV=1 156 411 3.0E-48
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 158 401 4.0E-48
sp|P63343|FTSH_SALTY ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ftsH PE=3 SV=1 163 403 4.0E-48
sp|P63344|FTSH_SALTI ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhi GN=ftsH PE=3 SV=1 163 403 4.0E-48
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 160 389 4.0E-48
sp|Q2KJI7|AFG32_BOVIN AFG3-like protein 2 OS=Bos taurus GN=AFG3L2 PE=2 SV=1 161 410 4.0E-48
sp|P71377|FTSH_HAEIN ATP-dependent zinc metalloprotease FtsH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsH PE=3 SV=1 162 403 4.0E-48
sp|A8F7F7|FTSH_PSELT ATP-dependent zinc metalloprotease FtsH OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ftsH PE=3 SV=1 162 410 5.0E-48
sp|D3FFN2|FTSH_MYCGH ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma gallisepticum (strain R(high / passage 156)) GN=ftsH PE=3 SV=1 159 421 5.0E-48
sp|A1URA3|FTSH_BARBK ATP-dependent zinc metalloprotease FtsH OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ftsH PE=3 SV=1 150 403 5.0E-48
sp|Q1D491|FTSH_MYXXD ATP-dependent zinc metalloprotease FtsH OS=Myxococcus xanthus (strain DK 1622) GN=ftsH PE=3 SV=1 150 403 6.0E-48
sp|Q2SF13|FTSH_HAHCH ATP-dependent zinc metalloprotease FtsH OS=Hahella chejuensis (strain KCTC 2396) GN=ftsH PE=3 SV=1 158 410 7.0E-48
sp|Q8JZQ2|AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus GN=Afg3l2 PE=1 SV=1 161 410 7.0E-48
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 160 389 8.0E-48
sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 160 389 8.0E-48
sp|D0LWB8|FTSH_HALO1 ATP-dependent zinc metalloprotease FtsH OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=ftsH PE=3 SV=1 150 410 8.0E-48
sp|A9GAW6|FTSH3_SORC5 ATP-dependent zinc metalloprotease FtsH 3 OS=Sorangium cellulosum (strain So ce56) GN=ftsH3 PE=3 SV=1 162 389 9.0E-48
sp|C8XAR0|ARC_NAKMY Proteasome-associated ATPase OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / JCM 9543 / Y-104) GN=arc PE=3 SV=1 64 358 9.0E-48
sp|Q6H6R9|FTSH7_ORYSJ ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH7 PE=3 SV=1 162 410 1.0E-47
sp|Q9HGM3|YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yta12 PE=3 SV=1 149 403 1.0E-47
sp|B8I4B9|FTSH_CLOCE ATP-dependent zinc metalloprotease FtsH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ftsH PE=3 SV=1 150 403 1.0E-47
sp|Q1RGP0|FTSH_RICBR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia bellii (strain RML369-C) GN=ftsH PE=3 SV=1 150 411 1.0E-47
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 162 389 2.0E-47
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 161 402 2.0E-47
sp|Q9ZEA2|FTSH_RICPR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia prowazekii (strain Madrid E) GN=ftsH PE=3 SV=1 150 410 2.0E-47
sp|Q92JJ9|FTSH_RICCN ATP-dependent zinc metalloprotease FtsH OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ftsH PE=3 SV=1 150 410 2.0E-47
sp|C7N1I1|FTSH_SLAHD ATP-dependent zinc metalloprotease FtsH OS=Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) GN=ftsH PE=3 SV=1 157 395 2.0E-47
sp|B4SCV5|FTSH_PELPB ATP-dependent zinc metalloprotease FtsH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ftsH PE=3 SV=1 162 403 2.0E-47
sp|Q68XR9|FTSH_RICTY ATP-dependent zinc metalloprotease FtsH OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ftsH PE=3 SV=1 150 410 2.0E-47
sp|A0JWY3|ARC_ARTS2 Proteasome-associated ATPase OS=Arthrobacter sp. (strain FB24) GN=arc PE=3 SV=1 112 333 2.0E-47
sp|A1TZE0|FTSH_MARHV ATP-dependent zinc metalloprotease FtsH OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ftsH PE=3 SV=1 158 410 2.0E-47
sp|Q1PDW5|FTSH6_ARATH ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1 162 410 2.0E-47
sp|Q6LUJ8|FTSH_PHOPR ATP-dependent zinc metalloprotease FtsH OS=Photobacterium profundum GN=ftsH PE=3 SV=1 150 401 2.0E-47
sp|Q4UN68|FTSH_RICFE ATP-dependent zinc metalloprotease FtsH OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ftsH PE=3 SV=1 150 410 2.0E-47
sp|Q8FTE3|ARC_COREF AAA ATPase forming ring-shaped complexes OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=arc PE=3 SV=1 89 331 2.0E-47
sp|P59652|FTSH_STRR6 ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ftsH PE=3 SV=1 162 416 2.0E-47
sp|O69076|FTSH_STRPN ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ftsH PE=3 SV=3 162 416 2.0E-47
sp|B1AI94|FTSH_UREP2 ATP-dependent zinc metalloprotease FtsH OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ftsH PE=3 SV=1 150 416 2.0E-47
sp|Q60AK1|FTSH_METCA ATP-dependent zinc metalloprotease FtsH OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ftsH PE=3 SV=1 156 403 3.0E-47
sp|P73437|FTSH4_SYNY3 ATP-dependent zinc metalloprotease FtsH 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH4 PE=2 SV=1 162 410 3.0E-47
sp|Q8EUA6|FTSH_MYCPE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma penetrans (strain HF-2) GN=ftsH PE=3 SV=1 159 410 3.0E-47
sp|Q83FV7|FTSH_TROWT ATP-dependent zinc metalloprotease FtsH OS=Tropheryma whipplei (strain Twist) GN=ftsH PE=3 SV=1 154 391 3.0E-47
sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 158 389 4.0E-47
sp|D2NQQ7|FTSH_ROTMD ATP-dependent zinc metalloprotease FtsH OS=Rothia mucilaginosa (strain DY-18) GN=ftsH PE=3 SV=1 158 396 4.0E-47
sp|Q9WZ49|FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ftsH PE=1 SV=1 162 417 5.0E-47
sp|Q8NQD8|ARC_CORGL AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=arc PE=3 SV=1 89 331 5.0E-47
sp|A4QE83|ARC_CORGB AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain R) GN=arc PE=3 SV=1 89 331 5.0E-47
sp|Q4JVP5|ARC_CORJK AAA ATPase forming ring-shaped complexes OS=Corynebacterium jeikeium (strain K411) GN=arc PE=3 SV=1 102 331 5.0E-47
sp|B2JVU2|FTSH_BURP8 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ftsH PE=3 SV=1 162 417 5.0E-47
sp|A9FDV9|FTSH2_SORC5 ATP-dependent zinc metalloprotease FtsH 2 OS=Sorangium cellulosum (strain So ce56) GN=ftsH2 PE=3 SV=1 163 410 6.0E-47
sp|A1R6Q4|ARC_ARTAT Proteasome-associated ATPase OS=Arthrobacter aurescens (strain TC1) GN=arc PE=3 SV=1 94 333 6.0E-47
sp|A6TWP7|FTSH2_ALKMQ ATP-dependent zinc metalloprotease FtsH 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH2 PE=3 SV=1 157 410 7.0E-47
sp|B8H8L3|ARC_ARTCA Proteasome-associated ATPase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=arc PE=3 SV=1 112 333 7.0E-47
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 160 389 1.0E-46
sp|A0LN68|FTSH_SYNFM ATP-dependent zinc metalloprotease FtsH OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=ftsH PE=3 SV=1 156 416 1.0E-46
sp|A9BFL9|FTSH1_PETMO ATP-dependent zinc metalloprotease FtsH 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH1 PE=3 SV=1 162 410 1.0E-46
sp|Q0DHL4|FTSH8_ORYSJ ATP-dependent zinc metalloprotease FTSH 8, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH8 PE=3 SV=1 149 416 1.0E-46
sp|Q8S2A7|FTSH3_ORYSJ ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH3 PE=3 SV=1 151 416 1.0E-46
sp|Q3JEE4|FTSH_NITOC ATP-dependent zinc metalloprotease FtsH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ftsH PE=3 SV=1 162 395 2.0E-46
sp|Q920A7|AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus GN=Afg3l1 PE=1 SV=2 161 410 2.0E-46
sp|B8D065|FTSH_HALOH ATP-dependent zinc metalloprotease FtsH OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ftsH PE=3 SV=1 162 416 2.0E-46
sp|A4FBX6|ARC_SACEN Proteasome-associated ATPase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=arc PE=3 SV=1 102 333 3.0E-46
sp|Q6MLS7|FTSH1_BDEBA ATP-dependent zinc metalloprotease FtsH 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH1 PE=3 SV=1 150 403 3.0E-46
sp|A9EXK6|FTSH4_SORC5 ATP-dependent zinc metalloprotease FtsH 4 OS=Sorangium cellulosum (strain So ce56) GN=ftsH4 PE=3 SV=1 150 410 3.0E-46
sp|Q9BAE0|FTSH_MEDSA ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Medicago sativa GN=FTSH PE=2 SV=1 162 415 4.0E-46
sp|O32617|FTSH_HELFC ATP-dependent zinc metalloprotease FtsH OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ftsH PE=3 SV=1 158 410 4.0E-46
sp|B3DRN4|ARC_BIFLD AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum (strain DJO10A) GN=arc PE=3 SV=1 54 331 6.0E-46
sp|Q39102|FTSH1_ARATH ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Arabidopsis thaliana GN=FTSH1 PE=1 SV=2 162 415 6.0E-46
sp|C7PVU9|ARC_CATAD Proteasome-associated ATPase OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=arc PE=3 SV=1 97 333 7.0E-46
sp|Q8G3G6|ARC_BIFLO AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum (strain NCC 2705) GN=arc PE=3 SV=1 54 331 7.0E-46
sp|B7GUP3|ARC_BIFLS AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=arc PE=3 SV=1 54 331 8.0E-46
sp|A9BHD3|FTSH2_PETMO ATP-dependent zinc metalloprotease FtsH 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH2 PE=3 SV=1 162 410 9.0E-46
sp|B1VDV2|ARC_CORU7 AAA ATPase forming ring-shaped complexes OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=arc PE=3 SV=1 102 331 1.0E-45
sp|D2NT89|ARC_ROTMD AAA ATPase forming ring-shaped complexes OS=Rothia mucilaginosa (strain DY-18) GN=arc PE=3 SV=2 94 331 1.0E-45
sp|Q39444|FTSH_CAPAN ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) OS=Capsicum annuum GN=FTSH PE=2 SV=1 162 415 1.0E-45
sp|D2S6D9|ARC_GEOOG Proteasome-associated ATPase OS=Geodermatophilus obscurus (strain ATCC 25078 / DSM 43160 / JCM 3152 / G-20) GN=arc PE=3 SV=1 102 333 2.0E-45
sp|C3PGA0|ARC_CORA7 AAA ATPase forming ring-shaped complexes OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=arc PE=3 SV=1 89 341 2.0E-45
sp|O82150|FTSH_TOBAC ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Nicotiana tabacum GN=FTSH PE=2 SV=2 162 415 2.0E-45
sp|Q54CS8|PEX6_DICDI Peroxisomal biogenesis factor 6 OS=Dictyostelium discoideum GN=pex6 PE=3 SV=1 154 383 2.0E-45
sp|Q5Z974|FTSH1_ORYSJ ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH1 PE=2 SV=1 162 415 2.0E-45
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 162 389 3.0E-45
sp|A9WSI4|ARC_RENSM Proteasome-associated ATPase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=arc PE=3 SV=1 94 333 3.0E-45
sp|A2SHH9|FTSH_METPP ATP-dependent zinc metalloprotease FtsH OS=Methylibium petroleiphilum (strain PM1) GN=ftsH PE=3 SV=1 162 410 3.0E-45
sp|D5H7Z5|FTSH1_SALRM ATP-dependent zinc metalloprotease FtsH 1 OS=Salinibacter ruber (strain M8) GN=ftsH1 PE=3 SV=1 162 417 3.0E-45
sp|Q47NX7|ARC_THEFY Proteasome-associated ATPase OS=Thermobifida fusca (strain YX) GN=arc PE=3 SV=1 102 333 4.0E-45
sp|B2A3Q4|FTSH_NATTJ ATP-dependent zinc metalloprotease FtsH OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ftsH PE=3 SV=1 156 411 5.0E-45
sp|Q3JMH0|FTSH_BURP1 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia pseudomallei (strain 1710b) GN=ftsH PE=3 SV=2 159 410 5.0E-45
sp|A4X741|ARC_SALTO Proteasome-associated ATPase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=arc PE=3 SV=1 102 333 6.0E-45
sp|P40341|YTA12_YEAST Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA12 PE=1 SV=2 162 389 6.0E-45
sp|A0QZ54|ARC_MYCS2 Proteasome-associated ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mpa PE=1 SV=1 157 333 6.0E-45
sp|Q1B795|ARC_MYCSS Proteasome-associated ATPase OS=Mycobacterium sp. (strain MCS) GN=mpa PE=3 SV=1 157 333 7.0E-45
sp|A1UHT0|ARC_MYCSK Proteasome-associated ATPase OS=Mycobacterium sp. (strain KMS) GN=mpa PE=3 SV=1 157 333 7.0E-45
sp|A3Q196|ARC_MYCSJ Proteasome-associated ATPase OS=Mycobacterium sp. (strain JLS) GN=mpa PE=3 SV=1 157 333 7.0E-45
sp|B2GIP2|ARC_KOCRD AAA ATPase forming ring-shaped complexes OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=arc PE=3 SV=1 89 347 8.0E-45
sp|A8M2A0|ARC_SALAI Proteasome-associated ATPase OS=Salinispora arenicola (strain CNS-205) GN=arc PE=3 SV=1 102 333 8.0E-45
sp|B7T1V0|FTSH_VAULI ATP-dependent zinc metalloprotease FtsH OS=Vaucheria litorea GN=ftsH PE=3 SV=1 161 410 8.0E-45
sp|D1CDT8|FTSH_THET1 ATP-dependent zinc metalloprotease FtsH OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) GN=ftsH PE=3 SV=1 156 403 8.0E-45
sp|P9WQN5|ARC_MYCTU Proteasome-associated ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mpa PE=1 SV=1 157 333 9.0E-45
sp|P9WQN4|ARC_MYCTO Proteasome-associated ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mpa PE=1 SV=1 157 333 9.0E-45
sp|C6DPU6|ARC_MYCTK Proteasome-associated ATPase OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=mpa PE=3 SV=1 157 333 9.0E-45
sp|A5WP89|ARC_MYCTF Proteasome-associated ATPase OS=Mycobacterium tuberculosis (strain F11) GN=mpa PE=3 SV=1 157 333 9.0E-45
sp|A5U4E1|ARC_MYCTA Proteasome-associated ATPase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mpa PE=3 SV=1 157 333 9.0E-45
sp|C1AQ31|ARC_MYCBT Proteasome-associated ATPase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=mpa PE=3 SV=1 157 333 9.0E-45
sp|A1KKF8|ARC_MYCBP Proteasome-associated ATPase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=mpa PE=3 SV=1 157 333 9.0E-45
sp|P63346|ARC_MYCBO Proteasome-associated ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mpa PE=3 SV=1 157 333 9.0E-45
sp|Q9FH02|FTSH5_ARATH ATP-dependent zinc metalloprotease FTSH 5, chloroplastic OS=Arabidopsis thaliana GN=FTSH5 PE=1 SV=1 162 415 9.0E-45
sp|B1MAH2|ARC_MYCA9 Proteasome-associated ATPase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=mpa PE=3 SV=1 157 333 1.0E-44
sp|Q3ULF4|SPG7_MOUSE Paraplegin OS=Mus musculus GN=Spg7 PE=1 SV=1 162 416 1.0E-44
sp|D2ATX1|ARC_STRRD Proteasome-associated ATPase OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) GN=arc PE=3 SV=1 97 333 2.0E-44
sp|Q9ZM66|FTSH_HELPJ ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ftsH PE=3 SV=1 158 410 2.0E-44
sp|D1BLD0|FTSH_VEIPT ATP-dependent zinc metalloprotease FtsH OS=Veillonella parvula (strain ATCC 10790 / DSM 2008 / JCM 12972 / Te3) GN=ftsH PE=3 SV=1 162 403 2.0E-44
sp|D3EZK2|FTSH3_CONWI ATP-dependent zinc metalloprotease FtsH 3 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH3 PE=3 SV=1 162 410 2.0E-44
sp|Q8VZI8|FTSHA_ARATH ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana GN=FTSH10 PE=1 SV=1 157 416 3.0E-44
sp|Q84WU8|FTSH3_ARATH ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana GN=FTSH3 PE=1 SV=1 159 416 3.0E-44
sp|B9MPK5|FTSH_CALBD ATP-dependent zinc metalloprotease FtsH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ftsH PE=3 SV=1 157 374 3.0E-44
sp|C6A7B2|ARC_BIFLB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain Bl-04 / DGCC2908 / RB 4825 / SD5219) GN=arc PE=3 SV=1 102 364 4.0E-44
sp|C6AHX0|ARC_BIFAS AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain DSM 10140 / JCM 10602 / LMG 18314) GN=arc PE=3 SV=1 102 364 4.0E-44
sp|B8DTX4|ARC_BIFA0 AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=arc PE=3 SV=1 102 364 4.0E-44
sp|D3R4I7|ARC_BIFAB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain BB-12) GN=arc PE=3 SV=1 102 364 4.0E-44
sp|Q9UQ90|SPG7_HUMAN Paraplegin OS=Homo sapiens GN=SPG7 PE=1 SV=2 162 416 4.0E-44
sp|C7MWW2|ARC_SACVD Proteasome-associated ATPase OS=Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / NBRC 12207 / P101) GN=arc PE=3 SV=1 102 333 4.0E-44
sp|P71408|FTSH_HELPY ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ftsH PE=1 SV=2 158 410 4.0E-44
sp|D1BS23|ARC_XYLCX Proteasome-associated ATPase OS=Xylanimonas cellulosilytica (strain DSM 15894 / CECT 5975 / LMG 20990 / XIL07) GN=arc PE=3 SV=1 94 333 4.0E-44
sp|D1BHU2|ARC_SANKS Proteasome-associated ATPase OS=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) GN=arc PE=3 SV=1 94 333 5.0E-44
sp|B2HFW2|ARC_MYCMM Proteasome-associated ATPase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=mpa PE=3 SV=1 157 333 5.0E-44
sp|A0QFB2|ARC_MYCA1 Proteasome-associated ATPase OS=Mycobacterium avium (strain 104) GN=mpa PE=3 SV=2 157 333 5.0E-44
sp|Q7URM7|FTSH2_RHOBA ATP-dependent zinc metalloprotease FtsH 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH2 PE=3 SV=1 163 416 5.0E-44
sp|A0PQT9|ARC_MYCUA Proteasome-associated ATPase OS=Mycobacterium ulcerans (strain Agy99) GN=mpa PE=3 SV=1 157 333 5.0E-44
sp|A1TAQ3|ARC_MYCVP Proteasome-associated ATPase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mpa PE=3 SV=1 157 333 5.0E-44
sp|P46509|ARC_MYCLE Proteasome-associated ATPase OS=Mycobacterium leprae (strain TN) GN=mpa PE=3 SV=1 157 333 5.0E-44
sp|B8ZRF0|ARC_MYCLB Proteasome-associated ATPase OS=Mycobacterium leprae (strain Br4923) GN=mpa PE=3 SV=1 157 333 5.0E-44
sp|C8WEG0|FTSH_ZYMMN ATP-dependent zinc metalloprotease FtsH OS=Zymomonas mobilis subsp. mobilis (strain NCIMB 11163 / B70) GN=ftsH PE=3 SV=1 150 410 5.0E-44
sp|B3QZS3|FTSH2_PHYMT ATP-dependent zinc metalloprotease FtsH 2 OS=Phytoplasma mali (strain AT) GN=ftsH2 PE=3 SV=1 161 416 5.0E-44
sp|A4TB65|ARC_MYCGI Proteasome-associated ATPase OS=Mycobacterium gilvum (strain PYR-GCK) GN=mpa PE=3 SV=1 157 333 6.0E-44
sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 110 391 6.0E-44
sp|Q2LUQ1|FTSH_SYNAS ATP-dependent zinc metalloprotease FtsH OS=Syntrophus aciditrophicus (strain SB) GN=ftsH PE=3 SV=1 157 410 7.0E-44
sp|B2XTF7|FTSH_HETA2 ATP-dependent zinc metalloprotease FtsH OS=Heterosigma akashiwo (strain NIES-293) GN=ftsH PE=3 SV=1 191 410 8.0E-44
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 158 388 8.0E-44
sp|C5CES8|FTSH_KOSOT ATP-dependent zinc metalloprotease FtsH OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ftsH PE=3 SV=1 161 410 8.0E-44
sp|Q54GX5|PEX1_DICDI Peroxisome biogenesis factor 1 OS=Dictyostelium discoideum GN=pex1 PE=3 SV=1 161 389 9.0E-44
sp|Q6MDI5|FTSH_PARUW ATP-dependent zinc metalloprotease FtsH OS=Protochlamydia amoebophila (strain UWE25) GN=ftsH PE=3 SV=1 162 392 1.0E-43
sp|A9NE17|FTSH_ACHLI ATP-dependent zinc metalloprotease FtsH OS=Acholeplasma laidlawii (strain PG-8A) GN=ftsH PE=3 SV=1 162 403 2.0E-43
sp|D1A2S5|ARC_THECD Proteasome-associated ATPase OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) GN=arc PE=3 SV=1 160 333 2.0E-43
sp|Q6FW67|PEX6_CANGA Peroxisomal biogenesis factor 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PEX6 PE=3 SV=1 64 394 2.0E-43
sp|P39925|AFG3_YEAST Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG3 PE=1 SV=1 162 410 2.0E-43
sp|B3DV46|FTSH1_METI4 ATP-dependent zinc metalloprotease FtsH 1 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH1 PE=3 SV=1 150 410 2.0E-43
sp|Q6MJV1|FTSH2_BDEBA ATP-dependent zinc metalloprotease FtsH 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH2 PE=3 SV=1 150 410 2.0E-43
sp|A1SK07|ARC_NOCSJ Proteasome-associated ATPase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=arc PE=3 SV=1 97 381 2.0E-43
sp|C5CBU4|ARC_MICLC AAA ATPase forming ring-shaped complexes OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=arc PE=3 SV=1 157 331 2.0E-43
sp|D2Q4G5|ARC_KRIFD Proteasome-associated ATPase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) GN=arc PE=3 SV=1 97 333 3.0E-43
sp|A5W382|FTSH_PSEP1 ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ftsH PE=3 SV=1 162 410 3.0E-43
sp|A9KIG5|FTSH_CLOPH ATP-dependent zinc metalloprotease FtsH OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ftsH PE=3 SV=1 191 411 3.0E-43
sp|C5BVA6|ARC_BEUC1 Proteasome-associated ATPase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=arc PE=3 SV=1 94 332 3.0E-43
sp|Q6KHA4|FTSH_MYCMO ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ftsH PE=3 SV=1 162 389 3.0E-43
sp|C7LYP4|ARC_ACIFD Proteasome-associated ATPase OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=arc PE=3 SV=1 112 363 3.0E-43
sp|D3Q568|ARC_STANL Proteasome-associated ATPase OS=Stackebrandtia nassauensis (strain DSM 44728 / NRRL B-16338 / NBRC 102104 / LLR-40K-21) GN=arc PE=3 SV=1 94 361 3.0E-43
sp|C6WIC8|ARC_ACTMD Proteasome-associated ATPase OS=Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / NBRC 14064 / IMRU 3971) GN=arc PE=3 SV=1 112 333 3.0E-43
sp|A9BJK3|FTSH3_PETMO ATP-dependent zinc metalloprotease FtsH 3 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH3 PE=3 SV=1 158 410 3.0E-43
sp|Q9UVU5|PEX6_PICAN Peroxisomal biogenesis factor 6 OS=Pichia angusta GN=PEX6 PE=1 SV=1 153 395 4.0E-43
sp|Q5YUW4|ARC_NOCFA Proteasome-associated ATPase OS=Nocardia farcinica (strain IFM 10152) GN=arc PE=3 SV=1 157 333 4.0E-43
sp|O50202|ARC_RHOER Proteasome-associated ATPase OS=Rhodococcus erythropolis GN=arc PE=1 SV=1 157 333 5.0E-43
sp|C0ZZV2|ARC_RHOE4 Proteasome-associated ATPase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=arc PE=3 SV=1 157 333 5.0E-43
sp|A8MPR5|FTSI2_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 2, chloroplastic OS=Arabidopsis thaliana GN=FTSHI2 PE=1 SV=1 161 413 8.0E-43
sp|Q9ZPR1|CD48B_ARATH Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 158 391 8.0E-43
sp|D1AXT4|FTSH_STRM9 ATP-dependent zinc metalloprotease FtsH OS=Streptobacillus moniliformis (strain ATCC 14647 / DSM 12112 / NCTC 10651 / 9901) GN=ftsH PE=3 SV=1 158 416 9.0E-43
sp|C1ASQ2|ARC_RHOOB Proteasome-associated ATPase OS=Rhodococcus opacus (strain B4) GN=arc PE=3 SV=1 157 333 1.0E-42
sp|Q0SIF4|ARC_RHOJR Proteasome-associated ATPase OS=Rhodococcus jostii (strain RHA1) GN=arc PE=3 SV=1 157 333 1.0E-42
sp|Q8RY16|PEX6_ARATH Peroxisome biogenesis protein 6 OS=Arabidopsis thaliana GN=PEX6 PE=1 SV=1 152 389 1.0E-42
sp|C4LIL2|ARC_CORK4 AAA ATPase forming ring-shaped complexes OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=arc PE=3 SV=2 145 386 1.0E-42
sp|Q0RLU1|ARC_FRAAA Proteasome-associated ATPase OS=Frankia alni (strain ACN14a) GN=arc PE=3 SV=2 160 381 2.0E-42
sp|D0LDS6|ARC_GORB4 Proteasome-associated ATPase OS=Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / JCM 3198 / NCTC 10667) GN=arc PE=3 SV=1 157 333 2.0E-42
sp|Q5SI82|FTSH_THET8 ATP-dependent zinc metalloprotease FtsH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ftsH PE=1 SV=1 158 403 2.0E-42
sp|A0LU46|ARC_ACIC1 Proteasome-associated ATPase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=arc PE=3 SV=1 92 333 2.0E-42
sp|Q2NIN5|FTSH_AYWBP ATP-dependent zinc metalloprotease FtsH OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=ftsH PE=3 SV=1 163 382 2.0E-42
sp|A6W963|ARC_KINRD Proteasome-associated ATPase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=arc PE=3 SV=1 160 333 3.0E-42
sp|O67077|FTSH_AQUAE ATP-dependent zinc metalloprotease FtsH OS=Aquifex aeolicus (strain VF5) GN=ftsH PE=1 SV=1 157 374 3.0E-42
sp|Q03Z46|FTSH_LEUMM ATP-dependent zinc metalloprotease FtsH OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ftsH PE=3 SV=1 162 403 4.0E-42
sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 160 388 4.0E-42
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 157 389 5.0E-42
sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 161 389 5.0E-42
sp|A6TSZ1|FTSH1_ALKMQ ATP-dependent zinc metalloprotease FtsH 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH1 PE=3 SV=1 162 410 5.0E-42
sp|Q4A5F0|FTSH_MYCS5 ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma synoviae (strain 53) GN=ftsH PE=3 SV=2 159 398 5.0E-42
sp|Q67WJ2|FTSH6_ORYSJ ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH6 PE=3 SV=1 143 410 5.0E-42
sp|C7MCZ0|ARC_BRAFD AAA ATPase forming ring-shaped complexes OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=arc PE=3 SV=1 73 341 7.0E-42
sp|Q9C1E9|PEX6_COLOR Peroxisomal biogenesis factor 6 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PEX6 PE=3 SV=2 154 388 8.0E-42
sp|A9GRC9|FTSH1_SORC5 ATP-dependent zinc metalloprotease FtsH 1 OS=Sorangium cellulosum (strain So ce56) GN=ftsH1 PE=3 SV=1 162 403 8.0E-42
sp|C9Z319|ARC_STRSW Proteasome-associated ATPase OS=Streptomyces scabiei (strain 87.22) GN=arc PE=3 SV=2 97 333 8.0E-42
sp|Q88Z31|FTSH_LACPL ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ftsH PE=2 SV=1 191 410 1.0E-41
sp|C6VKW6|FTSH_LACPJ ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain JDM1) GN=ftsH PE=3 SV=1 191 410 1.0E-41
sp|Q2J9Q0|ARC_FRASC Proteasome-associated ATPase OS=Frankia sp. (strain CcI3) GN=arc PE=3 SV=1 160 332 1.0E-41
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 157 389 2.0E-41
sp|O13764|PEX6_SCHPO Peroxisomal ATPase pex6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex6 PE=3 SV=1 160 389 2.0E-41
sp|Q9M895|FTSI3_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic OS=Arabidopsis thaliana GN=FTSHI3 PE=1 SV=1 158 414 2.0E-41
sp|A8LH57|ARC_FRASN Proteasome-associated ATPase OS=Frankia sp. (strain EAN1pec) GN=arc PE=3 SV=1 160 332 2.0E-41
sp|B1W303|ARC_STRGG Proteasome-associated ATPase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=arc PE=3 SV=1 97 333 3.0E-41
sp|Q9FNP1|PEX1_ARATH Peroxisome biogenesis protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=2 156 392 3.0E-41
sp|O80983|FTSH4_ARATH ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana GN=FTSH4 PE=1 SV=2 164 403 3.0E-41
sp|Q5BL07|PEX1_MOUSE Peroxisome biogenesis factor 1 OS=Mus musculus GN=Pex1 PE=1 SV=2 158 389 5.0E-41
sp|Q828J2|ARC_STRAW Proteasome-associated ATPase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=arc PE=3 SV=1 97 333 6.0E-41
sp|Q67LC0|FTSH1_SYMTH ATP-dependent zinc metalloprotease FtsH 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH1 PE=3 SV=1 162 395 7.0E-41
sp|C5J6A7|FTSH_MYCCR ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma conjunctivae (strain ATCC 25834 / HRC/581 / NCTC 10147) GN=ftsH PE=3 SV=1 132 416 7.0E-41
sp|Q9RJ58|ARC_STRCO Proteasome-associated ATPase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=arc PE=3 SV=1 97 333 8.0E-41
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 110 421 9.0E-41
sp|Q98PE4|FTSH_MYCPU ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ftsH PE=3 SV=1 159 403 1.0E-40
sp|P32795|YME1_YEAST Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YME1 PE=1 SV=1 159 403 1.0E-40
sp|B0B970|FTSH_CHLT2 ATP-dependent zinc metalloprotease FtsH OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ftsH PE=3 SV=1 150 374 1.0E-40
sp|Q9FGM0|FTSHB_ARATH ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=FTSH11 PE=1 SV=1 158 417 1.0E-40
sp|B3PNH3|FTSH_MYCA5 ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma arthritidis (strain 158L3-1) GN=ftsH PE=3 SV=1 191 403 2.0E-40
sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1 115 389 4.0E-40
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 161 388 5.0E-40
sp|Q8LQJ8|FTSH5_ORYSJ ATP-dependent zinc metalloprotease FTSH 5, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH5 PE=3 SV=1 161 403 5.0E-40
sp|Q74Z13|PEX6_ASHGO Peroxisomal biogenesis factor 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PEX6 PE=3 SV=1 154 388 5.0E-40
sp|Q6CPV1|PEX6_KLULA Peroxisomal biogenesis factor 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PEX6 PE=3 SV=1 154 388 5.0E-40
sp|P54813|YME1_CAEEL ATP-dependent zinc metalloprotease YME1 homolog OS=Caenorhabditis elegans GN=ymel-1 PE=3 SV=2 158 403 6.0E-40
sp|P33289|PEX6_PICPA Peroxisomal biogenesis factor 6 OS=Komagataella pastoris GN=PEX6 PE=3 SV=1 154 394 6.0E-40
sp|A2ZVG7|FTSH9_ORYSJ ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH9 PE=3 SV=1 158 417 7.0E-40
sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2 154 406 7.0E-40
sp|Q8LQJ9|FTSH4_ORYSJ ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH4 PE=3 SV=1 164 403 1.0E-39
sp|P40340|TBP7_YEAST Tat-binding homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA7 PE=1 SV=2 154 389 2.0E-39
sp|D2QZ34|FTSH_PIRSD ATP-dependent zinc metalloprotease FtsH OS=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) GN=ftsH PE=3 SV=1 154 394 2.0E-39
sp|C7R400|ARC_JONDD Proteasome-associated ATPase OS=Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) GN=arc PE=3 SV=1 160 333 2.0E-39
sp|P33760|PEX6_YEAST Peroxisomal ATPase PEX6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX6 PE=1 SV=1 154 329 2.0E-39
sp|P52917|VPS4_YEAST Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS4 PE=1 SV=1 158 389 3.0E-39
sp|Q9HG03|PEX6_PENCH Peroxisomal biogenesis factor 6 OS=Penicillium chrysogenum GN=pex6 PE=3 SV=1 154 388 5.0E-39
sp|F4KF14|FTSI4_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 4, chloroplastic OS=Arabidopsis thaliana GN=FTSHI4 PE=1 SV=1 149 418 6.0E-39
sp|O74941|PEX1_SCHPO Peroxisomal ATPase pex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex1 PE=3 SV=1 159 416 7.0E-39
sp|O59824|YME1_SCHPO ATP-dependent zinc metalloprotease YME1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.04c PE=3 SV=1 161 401 7.0E-39
sp|Q5AG40|VPS4_CANAL Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS4 PE=2 SV=1 152 389 7.0E-39
sp|Q8CDM1|ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1 138 393 9.0E-39
sp|Q7SGP2|PEX6_NEUCR Peroxisomal biogenesis factor 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pex-6 PE=3 SV=1 154 388 9.0E-39
sp|Q7TT47|SPG7_RAT Paraplegin OS=Rattus norvegicus GN=Spg7 PE=2 SV=1 162 341 1.0E-38
sp|P54777|PEX6_RAT Peroxisome assembly factor 2 OS=Rattus norvegicus GN=Pex6 PE=1 SV=1 154 389 1.0E-38
sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1 138 393 1.0E-38
sp|P54816|TBP7_CAEEL Tat-binding homolog 7 OS=Caenorhabditis elegans GN=lex-1 PE=1 SV=3 141 393 2.0E-38
sp|Q6DDU8|FIGL1_XENLA Fidgetin-like protein 1 OS=Xenopus laevis GN=fignl1 PE=2 SV=1 157 389 2.0E-38
sp|Q99LC9|PEX6_MOUSE Peroxisome assembly factor 2 OS=Mus musculus GN=Pex6 PE=1 SV=1 154 389 2.0E-38
sp|Q6PIW4|FIGL1_HUMAN Fidgetin-like protein 1 OS=Homo sapiens GN=FIGNL1 PE=1 SV=2 157 389 2.0E-38
sp|O14114|YEJJ_SCHPO Uncharacterized AAA domain-containing protein C31G5.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.19 PE=3 SV=1 154 389 2.0E-38
sp|P46463|PEX1_PICPA Peroxisome biosynthesis protein PAS1 OS=Komagataella pastoris GN=PEX1 PE=3 SV=1 158 389 2.0E-38
sp|P46467|VPS4B_MOUSE Vacuolar protein sorting-associated protein 4B OS=Mus musculus GN=Vps4b PE=1 SV=2 158 389 3.0E-38
sp|A4IHT0|FIGL1_XENTR Fidgetin-like protein 1 OS=Xenopus tropicalis GN=fignl1 PE=2 SV=1 157 389 3.0E-38
sp|Q5RDX4|ATAD2_PONAB ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1 138 393 7.0E-38
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 161 388 9.0E-38
sp|Q6BS73|PEX6_DEBHA Peroxisomal biogenesis factor 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX6 PE=3 SV=2 154 388 9.0E-38
sp|O75351|VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens GN=VPS4B PE=1 SV=2 158 389 1.0E-37
sp|Q5R658|VPS4B_PONAB Vacuolar protein sorting-associated protein 4B OS=Pongo abelii GN=VPS4B PE=2 SV=1 158 389 2.0E-37
sp|Q8BPY9|FIGL1_MOUSE Fidgetin-like protein 1 OS=Mus musculus GN=Fignl1 PE=1 SV=1 157 389 4.0E-37
sp|Q0VD48|VPS4B_BOVIN Vacuolar protein sorting-associated protein 4B OS=Bos taurus GN=VPS4B PE=2 SV=1 158 389 4.0E-37
sp|A8X0L9|TBP7_CAEBR Tat-binding homolog 7 OS=Caenorhabditis briggsae GN=lex-1 PE=3 SV=2 141 393 4.0E-37
sp|Q9C0W2|YHI5_SCHPO Uncharacterized AAA domain-containing protein P22H7.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi026 PE=3 SV=1 161 389 4.0E-37
sp|P36966|PEX6_YARLI Peroxisomal biogenesis factor 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX6 PE=3 SV=2 154 388 5.0E-37
sp|Q6GX84|FIGL1_RAT Fidgetin-like protein 1 OS=Rattus norvegicus GN=Fignl1 PE=2 SV=1 157 389 5.0E-37
sp|Q9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3 121 398 7.0E-37
sp|F4IAE9|Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana GN=At1g05910 PE=2 SV=1 155 408 1.0E-36
sp|O61577|KTNA1_STRPU Katanin p60 ATPase-containing subunit A1 OS=Strongylocentrotus purpuratus GN=KATNA1 PE=1 SV=1 160 389 3.0E-36
sp|A0JMA9|KATL2_XENTR Katanin p60 ATPase-containing subunit A-like 2 OS=Xenopus tropicalis GN=katnal2 PE=2 SV=1 158 389 3.0E-36
sp|Q83XX3|FTSH_OENOE ATP-dependent zinc metalloprotease FtsH OS=Oenococcus oeni GN=ftsH PE=2 SV=1 191 416 4.0E-36
sp|Q6AZT2|SPAST_XENLA Spastin OS=Xenopus laevis GN=spast PE=2 SV=1 157 389 6.0E-36
sp|Q8IYT4|KATL2_HUMAN Katanin p60 ATPase-containing subunit A-like 2 OS=Homo sapiens GN=KATNAL2 PE=2 SV=3 160 389 8.0E-36
sp|B7PXE3|SPAST_IXOSC Spastin OS=Ixodes scapularis GN=spas PE=3 SV=1 148 389 2.0E-35
sp|Q925S8|YMEL1_RAT ATP-dependent zinc metalloprotease YME1L1 OS=Rattus norvegicus GN=Yme1l1 PE=2 SV=1 161 401 3.0E-35
sp|Q05AS3|SPAST_XENTR Spastin OS=Xenopus tropicalis GN=spast PE=2 SV=1 157 389 4.0E-35
sp|Q5RII9|KTNA1_DANRE Katanin p60 ATPase-containing subunit A1 OS=Danio rerio GN=katna1 PE=2 SV=1 158 389 4.0E-35
sp|Q9ZNT0|VPS4_ARATH Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 OS=Arabidopsis thaliana GN=SKD1 PE=1 SV=1 158 389 4.0E-35
sp|O75449|KTNA1_HUMAN Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens GN=KATNA1 PE=1 SV=1 158 389 5.0E-35
sp|P46508|YME1_SCHMA ATP-dependent zinc metalloprotease YME1 homolog OS=Schistosoma mansoni PE=2 SV=1 138 418 5.0E-35
sp|O88967|YMEL1_MOUSE ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus GN=Yme1l1 PE=1 SV=1 161 401 7.0E-35
sp|Q4R407|KTNA1_MACFA Katanin p60 ATPase-containing subunit A1 OS=Macaca fascicularis GN=KATNA1 PE=2 SV=1 158 389 1.0E-34
sp|Q96TA2|YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2 161 401 1.0E-34
sp|Q9D3R6|KATL2_MOUSE Katanin p60 ATPase-containing subunit A-like 2 OS=Mus musculus GN=Katnal2 PE=2 SV=2 160 389 1.0E-34
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 194 389 2.0E-34
sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 160 389 4.0E-33
sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 146 416 5.0E-33
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 160 388 6.0E-32
sp|Q9ZPR1|CD48B_ARATH Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 165 396 1.0E-30
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 194 394 2.0E-30
sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 194 394 6.0E-29
sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2 202 367 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016787 hydrolase activity No
GO:0016462 pyrophosphatase activity No
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5947
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|860 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7609
Ophiocordyceps camponoti-floridani Ophcf2|00634
Ophiocordyceps camponoti-rufipedis Ophun1|2247
Ophiocordyceps kimflemingae Ophio5|4811

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|860
MAEVAVESTANHAPPHRKAAPSAITAVDSFEGLPIDGGDDYANLKKLQRQLEYIQLQEEYIKDEQRSLKRELVRA
QEEIKRIQSVPLVIGQFMEAIDQNTGIVQSSTGSNYVVRILSTLDREKLKASSSVALHRHSNALVDILPPEADSS
IAMLGADEKPDVTYADVGGLDMQKQEIREAVELPLTHFDLYKQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTTA
SFIRVVGSEFVQKYLGEGPRMVRDVFRMARENSPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QTSNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFTTIASKMNLAPEADLDSLIVRNDPLSGAI
IAAIMQEAGLRAVRMNRYNIIQADLEDAYSSQVKGTGDENKFDFYK*
Coding >OphauG2|860
ATGGCCGAGGTGGCAGTCGAGAGCACGGCAAACCACGCGCCGCCACATAGAAAAGCTGCCCCTTCGGCAATTACC
GCCGTGGATAGCTTTGAAGGCTTGCCCATTGACGGCGGCGACGACTATGCAAACCTCAAGAAACTGCAGCGGCAG
TTGGAGTACATCCAACTGCAAGAGGAATACATCAAAGACGAACAGCGAAGCTTGAAGCGCGAGCTTGTTCGTGCT
CAAGAAGAAATCAAGCGCATTCAGAGCGTGCCTCTGGTCATTGGCCAATTTATGGAAGCCATCGACCAAAACACT
GGCATTGTGCAATCAAGCACCGGCTCCAACTATGTCGTGCGCATCCTGTCCACTCTCGATCGCGAAAAACTCAAG
GCCTCGTCTTCCGTCGCCCTGCACCGCCATTCCAATGCCCTTGTGGATATTCTCCCGCCGGAAGCCGACTCCTCC
ATTGCTATGCTCGGGGCCGATGAGAAGCCCGACGTGACGTATGCCGACGTTGGTGGTCTTGACATGCAAAAGCAA
GAGATTCGGGAGGCTGTAGAACTTCCCCTGACGCACTTTGACCTCTACAAGCAAATCGGAATCGACCCCCCCCGA
GGCGTCCTGCTCTACGGCCCACCTGGAACAGGCAAGACGATGCTCGTCAAGGCTGTTGCCAACTCGACAACGGCC
AGCTTCATCCGCGTCGTCGGCTCCGAGTTTGTGCAAAAATATCTCGGCGAGGGCCCGCGCATGGTACGCGACGTG
TTTCGCATGGCGCGCGAAAACTCTCCTGCCATTATCTTTATTGACGAGATTGACGCCATTGCCACGAAGCGCTTC
GATGCCCAGACGGGCGCCGACCGAGAAGTCCAGCGCATCTTGCTTGAGCTTCTCAACCAAATGGATGGCTTTGAC
CAAACCTCCAATGTCAAGGTCATCATGGCCACAAACCGCGCCGACACGCTGGATCCCGCCCTGCTGCGCCCCGGG
CGTCTGGACCGCAAGATTGAATTCCCCTCGCTGCGCGACCGCCGCGAACGCCGCCTCATCTTCACCACCATAGCC
AGCAAAATGAATCTGGCCCCCGAAGCTGATCTCGACAGCCTCATTGTCCGCAATGACCCCCTCTCGGGTGCTATT
ATTGCTGCCATTATGCAAGAGGCTGGCCTCCGTGCCGTGCGCATGAACCGCTACAACATTATTCAGGCTGACCTC
GAAGATGCATACTCGAGCCAGGTCAAGGGCACTGGCGACGAGAATAAATTCGACTTTTACAAGTAG
Transcript >OphauG2|860
ATGGCCGAGGTGGCAGTCGAGAGCACGGCAAACCACGCGCCGCCACATAGAAAAGCTGCCCCTTCGGCAATTACC
GCCGTGGATAGCTTTGAAGGCTTGCCCATTGACGGCGGCGACGACTATGCAAACCTCAAGAAACTGCAGCGGCAG
TTGGAGTACATCCAACTGCAAGAGGAATACATCAAAGACGAACAGCGAAGCTTGAAGCGCGAGCTTGTTCGTGCT
CAAGAAGAAATCAAGCGCATTCAGAGCGTGCCTCTGGTCATTGGCCAATTTATGGAAGCCATCGACCAAAACACT
GGCATTGTGCAATCAAGCACCGGCTCCAACTATGTCGTGCGCATCCTGTCCACTCTCGATCGCGAAAAACTCAAG
GCCTCGTCTTCCGTCGCCCTGCACCGCCATTCCAATGCCCTTGTGGATATTCTCCCGCCGGAAGCCGACTCCTCC
ATTGCTATGCTCGGGGCCGATGAGAAGCCCGACGTGACGTATGCCGACGTTGGTGGTCTTGACATGCAAAAGCAA
GAGATTCGGGAGGCTGTAGAACTTCCCCTGACGCACTTTGACCTCTACAAGCAAATCGGAATCGACCCCCCCCGA
GGCGTCCTGCTCTACGGCCCACCTGGAACAGGCAAGACGATGCTCGTCAAGGCTGTTGCCAACTCGACAACGGCC
AGCTTCATCCGCGTCGTCGGCTCCGAGTTTGTGCAAAAATATCTCGGCGAGGGCCCGCGCATGGTACGCGACGTG
TTTCGCATGGCGCGCGAAAACTCTCCTGCCATTATCTTTATTGACGAGATTGACGCCATTGCCACGAAGCGCTTC
GATGCCCAGACGGGCGCCGACCGAGAAGTCCAGCGCATCTTGCTTGAGCTTCTCAACCAAATGGATGGCTTTGAC
CAAACCTCCAATGTCAAGGTCATCATGGCCACAAACCGCGCCGACACGCTGGATCCCGCCCTGCTGCGCCCCGGG
CGTCTGGACCGCAAGATTGAATTCCCCTCGCTGCGCGACCGCCGCGAACGCCGCCTCATCTTCACCACCATAGCC
AGCAAAATGAATCTGGCCCCCGAAGCTGATCTCGACAGCCTCATTGTCCGCAATGACCCCCTCTCGGGTGCTATT
ATTGCTGCCATTATGCAAGAGGCTGGCCTCCGTGCCGTGCGCATGAACCGCTACAACATTATTCAGGCTGACCTC
GAAGATGCATACTCGAGCCAGGTCAAGGGCACTGGCGACGAGAATAAATTCGACTTTTACAAGTAG
Gene >OphauG2|860
ATGGCCGAGGTGGCAGTCGAGAGCACGGCAAACCACGCGCCGCCACATAGAAAAGCTGCCCCTTCGGCAATTACC
GCCGTGGATAGCTTTGAAGGCTTGCCCATTGACGGCGGCGACGACTATGCAAACCTCAAGAAACTGCAGCGGCAG
TTGGAGTGAATCTTGACTGTCTGATGCCTTTTGACTGGCTCAAGTCGTGGCTGACAAGTGGCCAGGTACATCCAA
CTGCAAGAGGAATACATCAAAGACGAACAGCGGTGAGTTGATACCTGGATGCTTTTCAGAACCGTCTTGTGACAA
GTCTGTTGTTTGCAGAAGCTTGAAGCGCGAGCTTGTTCGTGCTCAAGAAGAAATCAAGCGCATTCAGAGCGTGCC
TCTGGTCATTGGCCAATTTATGGAAGCCATCGACCAAAAGTGAGTTTCCATTTGACTCTGCATCCTCTCCCTCTC
ACTCTTGGCCAAAGTGCACTCCAGCTCATTGTCCTTGTAGCACTGGCATTGTGCAATCAAGCACCGGCTCCAACT
ATGTCGTGCGCATCCTGTCCACTCTCGATCGCGAAAAACTCAAGGCCTCGTCTTCCGTCGCCCTGCACCGCCATT
CCAATGCCCTTGTGGATATTCTCCCGCCGGAAGCCGACTCCTCCATTGCTATGCTCGGGGCCGATGAGAAGCCCG
ACGTGACGTATGCCGACGTTGGTGGTCTTGACATGCAAAAGCAAGAGATTCGGGAGGCTGTAGAACTTCCCCTGA
CGCACTTTGACCTCTACAAGCAAATCGGAATCGACCCCCCCCGAGGCGTCCTGCTCTACGGCCCACCTGGAACAG
GCAAGACGATGCTCGTCAAGGCTGTTGCCAACTCGACAACGGCCAGCTTCATCCGCGTCGTCGGCTCCGAGTTTG
TGCAAAAATATCTCGGCGAGGGCCCGCGCATGGTACGCGACGTGTTTCGCATGGCGCGCGAAAACTCTCCTGCCA
TTATCTTTATTGACGAGATTGACGCCATTGCCACGAAGCGCTTCGATGCCCAGACGGGCGCCGACCGAGAAGTCC
AGCGCATCTTGCTTGAGCTTCTCAACCAAATGGATGGCTTTGACCAAACCTCCAATGTCAAGGTCATCATGGCCA
CAAACCGCGCCGACACGCTGGATCCCGCCCTGCTGCGCCCCGGGCGTCTGGACCGCAAGATTGAATTCCCCTCGC
TGCGCGACCGCCGCGAACGCCGCCTCATCTTCACCACCATAGCCAGCAAAATGAATCTGGCCCCCGAAGCTGATC
TCGACAGCCTCATTGTCCGCAATGACCCCCTCTCGGGTGCTATTATTGCTGCCATTATGCAAGAGGCTGGCCTCC
GTGCCGTGCGCATGAACCGCTACAACATTATTCAGGCTGACCTCGAAGATGCATACTCGAGCCAGGTCAAGGGCA
CTGGCGACGAGAATAAATTCGACTTTTACAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail