Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|845
Gene name
LocationContig_122:10352..10952
Strand+
Gene length (bp)600
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999623

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7085
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|845 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8130
Ophiocordyceps subramaniannii Hirsu2|6384

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|845
MQFNLVTEMAFAGLIMSCATPQALAHPLVNAGLEQRATEQPAATPAGFAGLGNLFGGLGGQAGGAGAGEAAAKAE
TGTGTVAGTGAGAGIGGLGEILSDHAKYVASPQSATVPIPAAENNPVREGHRGAHVAIYQAISGAGAGAAQGGDA
AKDASETQ*
Coding >OphauG2|845
ATGCAGTTCAACTTGGTTACTGAAATGGCCTTTGCCGGACTCATAATGTCTTGTGCAACTCCTCAAGCACTGGCT
CATCCCCTTGTCAATGCTGGCCTTGAACAACGTGCCACCGAACAGCCAGCTGCTACCCCCGCCGGATTCGCAGGA
CTCGGCAATCTATTTGGCGGACTTGGAGGTCAAGCTGGAGGAGCTGGTGCTGGAGAAGCTGCTGCAAAAGCCGAA
ACCGGTACTGGAACTGTTGCTGGTACTGGTGCTGGTGCTGGCATAGGCGGACTTGGAGAGATCTTATCCGACCAT
GCCAAATATGTCGCCTCGCCTCAAAGCGCCACAGTTCCTATTCCTGCAGCGGAGAACAACCCTGTGCGCGAGGGT
CATCGTGGGGCCCATGTTGCTATTTACCAAGCTATCAGTGGTGCCGGTGCCGGTGCCGCACAAGGAGGTGATGCA
GCCAAGGATGCCTCGGAAACTCAATGA
Transcript >OphauG2|845
ATGCAGTTCAACTTGGTTACTGAAATGGCCTTTGCCGGACTCATAATGTCTTGTGCAACTCCTCAAGCACTGGCT
CATCCCCTTGTCAATGCTGGCCTTGAACAACGTGCCACCGAACAGCCAGCTGCTACCCCCGCCGGATTCGCAGGA
CTCGGCAATCTATTTGGCGGACTTGGAGGTCAAGCTGGAGGAGCTGGTGCTGGAGAAGCTGCTGCAAAAGCCGAA
ACCGGTACTGGAACTGTTGCTGGTACTGGTGCTGGTGCTGGCATAGGCGGACTTGGAGAGATCTTATCCGACCAT
GCCAAATATGTCGCCTCGCCTCAAAGCGCCACAGTTCCTATTCCTGCAGCGGAGAACAACCCTGTGCGCGAGGGT
CATCGTGGGGCCCATGTTGCTATTTACCAAGCTATCAGTGGTGCCGGTGCCGGTGCCGCACAAGGAGGTGATGCA
GCCAAGGATGCCTCGGAAACTCAATGA
Gene >OphauG2|845
ATGCAGTTCAACTTGGTTACTGAAATGGCCTTTGCCGGACTCATAATGTCTTGTGCAACTCCTCAAGCACTGGCT
CATCCCCTTGTCAATGGTAGGAGACGCACAATTATTTTGATGCATTGTTTCGCAGCTCTTTCGAGTCATCAAGTC
TTGCTATCGCATGAAACATATTATTTTTTTGTACTTGAAACTGATTCTCAAATCTGATGGTTAGCTGGCCTTGAA
CAACGTGCCACCGAACAGCCAGCTGCTACCCCCGCCGGATTCGCAGGACTCGGCAATCTATTTGGCGGACTTGGA
GGTCAAGCTGGAGGAGCTGGTGCTGGAGAAGCTGCTGCAAAAGCCGAAACCGGTACTGGAACTGTTGCTGGTACT
GGTGCTGGTGCTGGCATAGGCGGACTTGGAGAGATCTTATCCGACCATGCCAAATATGTCGCCTCGCCTCAAAGC
GCCACAGTTCCTATTCCTGCAGCGGAGAACAACCCTGTGCGCGAGGGTCATCGTGGGGCCCATGTTGCTATTTAC
CAAGCTATCAGTGGTGCCGGTGCCGGTGCCGCACAAGGAGGTGATGCAGCCAAGGATGCCTCGGAAACTCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail