Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|841
Gene name
LocationContig_122:3129..4062
Strand-
Gene length (bp)933
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A 1.4E-31 66 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36520|RM10_YEAST 54S ribosomal protein L10, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL10 PE=1 SV=2 31 257 7.0E-36
sp|Q9Y7M5|RM10_SCHPO 54S ribosomal protein L10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl10 PE=3 SV=2 37 258 7.0E-31
sp|B1Z774|RL15_METPB 50S ribosomal protein L15 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplO PE=3 SV=1 42 197 8.0E-31
sp|A9W4S1|RL15_METEP 50S ribosomal protein L15 OS=Methylobacterium extorquens (strain PA1) GN=rplO PE=3 SV=1 42 197 9.0E-31
sp|B7L0T1|RL15_METC4 50S ribosomal protein L15 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplO PE=3 SV=1 42 197 9.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36520|RM10_YEAST 54S ribosomal protein L10, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL10 PE=1 SV=2 31 257 7.0E-36
sp|Q9Y7M5|RM10_SCHPO 54S ribosomal protein L10, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl10 PE=3 SV=2 37 258 7.0E-31
sp|B1Z774|RL15_METPB 50S ribosomal protein L15 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplO PE=3 SV=1 42 197 8.0E-31
sp|A9W4S1|RL15_METEP 50S ribosomal protein L15 OS=Methylobacterium extorquens (strain PA1) GN=rplO PE=3 SV=1 42 197 9.0E-31
sp|B7L0T1|RL15_METC4 50S ribosomal protein L15 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplO PE=3 SV=1 42 197 9.0E-31
sp|B1LWQ7|RL15_METRJ 50S ribosomal protein L15 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplO PE=3 SV=1 42 192 9.0E-30
sp|Q98N38|RL15_RHILO 50S ribosomal protein L15 OS=Rhizobium loti (strain MAFF303099) GN=rplO PE=3 SV=1 42 188 4.0E-29
sp|C4KZM7|RL15_EXISA 50S ribosomal protein L15 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rplO PE=3 SV=1 42 188 4.0E-29
sp|Q9X1J0|RL15_THEMA 50S ribosomal protein L15 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplO PE=3 SV=1 42 187 5.0E-29
sp|B1LBM1|RL15_THESQ 50S ribosomal protein L15 OS=Thermotoga sp. (strain RQ2) GN=rplO PE=3 SV=1 42 187 9.0E-29
sp|A5IMA2|RL15_THEP1 50S ribosomal protein L15 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rplO PE=3 SV=1 42 187 9.0E-29
sp|B9K8A5|RL15_THENN 50S ribosomal protein L15 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rplO PE=3 SV=1 42 187 1.0E-28
sp|B2G8V9|RL15_LACRJ 50S ribosomal protein L15 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplO PE=3 SV=1 42 188 2.0E-28
sp|A5VLI6|RL15_LACRD 50S ribosomal protein L15 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplO PE=3 SV=1 42 188 2.0E-28
sp|B8ISA4|RL15_METNO 50S ribosomal protein L15 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rplO PE=3 SV=1 42 188 2.0E-28
sp|Q1WSA9|RL15_LACS1 50S ribosomal protein L15 OS=Lactobacillus salivarius (strain UCC118) GN=rplO PE=3 SV=1 50 188 6.0E-28
sp|A1B047|RL15_PARDP 50S ribosomal protein L15 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplO PE=3 SV=1 42 190 7.0E-28
sp|Q03ED5|RL15_PEDPA 50S ribosomal protein L15 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rplO PE=3 SV=1 42 188 1.0E-27
sp|B4R8N6|RL15_PHEZH 50S ribosomal protein L15 OS=Phenylobacterium zucineum (strain HLK1) GN=rplO PE=3 SV=1 42 190 1.0E-27
sp|P35139|RL15_STACT 50S ribosomal protein L15 OS=Staphylococcus carnosus (strain TM300) GN=rplO PE=3 SV=2 55 186 2.0E-27
sp|A4YSL1|RL15_BRASO 50S ribosomal protein L15 OS=Bradyrhizobium sp. (strain ORS278) GN=rplO PE=3 SV=1 42 188 4.0E-27
sp|A8LM76|RL15_DINSH 50S ribosomal protein L15 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplO PE=3 SV=1 42 190 4.0E-27
sp|Q2K9J7|RL15_RHIEC 50S ribosomal protein L15 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rplO PE=3 SV=1 42 188 6.0E-27
sp|Q2RQX9|RL15_RHORT 50S ribosomal protein L15 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplO PE=3 SV=1 42 186 7.0E-27
sp|Q1MIC2|RL15_RHIL3 50S ribosomal protein L15 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rplO PE=3 SV=1 42 188 8.0E-27
sp|P38373|RL15_BACHD 50S ribosomal protein L15 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplO PE=3 SV=2 55 188 1.0E-26
sp|B0UHV0|RL15_METS4 50S ribosomal protein L15 OS=Methylobacterium sp. (strain 4-46) GN=rplO PE=3 SV=1 42 188 2.0E-26
sp|Q49ZE9|RL15_STAS1 50S ribosomal protein L15 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplO PE=3 SV=1 55 186 2.0E-26
sp|B3PWU0|RL15_RHIE6 50S ribosomal protein L15 OS=Rhizobium etli (strain CIAT 652) GN=rplO PE=3 SV=1 42 188 2.0E-26
sp|B5ZYV4|RL15_RHILW 50S ribosomal protein L15 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rplO PE=3 SV=1 42 188 2.0E-26
sp|A6U878|RL15_SINMW 50S ribosomal protein L15 OS=Sinorhizobium medicae (strain WSM419) GN=rplO PE=3 SV=1 42 188 2.0E-26
sp|Q92QF1|RL15_RHIME 50S ribosomal protein L15 OS=Rhizobium meliloti (strain 1021) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|Q8G090|RL15_BRUSU 50S ribosomal protein L15 OS=Brucella suis biovar 1 (strain 1330) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|B0CH13|RL15_BRUSI 50S ribosomal protein L15 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|A5VQY7|RL15_BRUO2 50S ribosomal protein L15 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|Q8YHM1|RL15_BRUME 50S ribosomal protein L15 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|C0RJI2|RL15_BRUMB 50S ribosomal protein L15 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|A9M5N1|RL15_BRUC2 50S ribosomal protein L15 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|Q57CS7|RL15_BRUAB 50S ribosomal protein L15 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|Q2YRT5|RL15_BRUA2 50S ribosomal protein L15 OS=Brucella abortus (strain 2308) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|B2S660|RL15_BRUA1 50S ribosomal protein L15 OS=Brucella abortus (strain S19) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|A5ELK8|RL15_BRASB 50S ribosomal protein L15 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplO PE=3 SV=1 42 188 3.0E-26
sp|B9KLB0|RL15_RHOSK 50S ribosomal protein L15 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplO PE=3 SV=1 42 189 4.0E-26
sp|Q3J5Q3|RL15_RHOS4 50S ribosomal protein L15 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplO PE=3 SV=1 42 189 4.0E-26
sp|A3PGN0|RL15_RHOS1 50S ribosomal protein L15 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplO PE=3 SV=1 42 189 4.0E-26
sp|A6X0D7|RL15_OCHA4 50S ribosomal protein L15 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplO PE=3 SV=1 42 188 5.0E-26
sp|Q28UT4|RL15_JANSC 50S ribosomal protein L15 OS=Jannaschia sp. (strain CCS1) GN=rplO PE=3 SV=1 45 186 6.0E-26
sp|A7HM33|RL15_FERNB 50S ribosomal protein L15 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rplO PE=3 SV=1 44 188 7.0E-26
sp|Q8R7X2|RL15_CALS4 50S ribosomal protein L15 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplO PE=3 SV=1 42 187 8.0E-26
sp|B0K5R1|RL15_THEPX 50S ribosomal protein L15 OS=Thermoanaerobacter sp. (strain X514) GN=rplO PE=3 SV=1 42 187 1.0E-25
sp|B0KCL8|RL15_THEP3 50S ribosomal protein L15 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplO PE=3 SV=1 42 187 1.0E-25
sp|Q03ZM7|RL15_LEUMM 50S ribosomal protein L15 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rplO PE=3 SV=1 42 186 1.0E-25
sp|B9MKG3|RL15_CALBD 50S ribosomal protein L15 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rplO PE=3 SV=1 42 188 1.0E-25
sp|A8AZK6|RL15_STRGC 50S ribosomal protein L15 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|A9VP96|RL15_BACWK 50S ribosomal protein L15 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|A4WVI9|RL15_RHOS5 50S ribosomal protein L15 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplO PE=3 SV=1 42 189 2.0E-25
sp|P04452|RL15_GEOSE 50S ribosomal protein L15 OS=Geobacillus stearothermophilus GN=rplO PE=1 SV=1 49 188 2.0E-25
sp|Q5L3S0|RL15_GEOKA 50S ribosomal protein L15 OS=Geobacillus kaustophilus (strain HTA426) GN=rplO PE=3 SV=1 49 188 2.0E-25
sp|C1CPA7|RL15_STRZT 50S ribosomal protein L15 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|C1CIB6|RL15_STRZP 50S ribosomal protein L15 OS=Streptococcus pneumoniae (strain P1031) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|C1CC25|RL15_STRZJ 50S ribosomal protein L15 OS=Streptococcus pneumoniae (strain JJA) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|Q8CWV0|RL15_STRR6 50S ribosomal protein L15 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|B2IS59|RL15_STRPS 50S ribosomal protein L15 OS=Streptococcus pneumoniae (strain CGSP14) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|Q97SU3|RL15_STRPN 50S ribosomal protein L15 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|B8ZKP9|RL15_STRPJ 50S ribosomal protein L15 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|B1I8L7|RL15_STRPI 50S ribosomal protein L15 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|C1CAN1|RL15_STRP7 50S ribosomal protein L15 OS=Streptococcus pneumoniae (strain 70585) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|B5E6H4|RL15_STRP4 50S ribosomal protein L15 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|Q04ML7|RL15_STRP2 50S ribosomal protein L15 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rplO PE=3 SV=1 55 188 2.0E-25
sp|Q6G2Y4|RL15_BARHE 50S ribosomal protein L15 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplO PE=3 SV=1 42 188 3.0E-25
sp|C5D3T6|RL15_GEOSW 50S ribosomal protein L15 OS=Geobacillus sp. (strain WCH70) GN=rplO PE=3 SV=1 49 188 3.0E-25
sp|B6JEY4|RL15_OLICO 50S ribosomal protein L15 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplO PE=3 SV=1 42 188 4.0E-25
sp|A3CK83|RL15_STRSV 50S ribosomal protein L15 OS=Streptococcus sanguinis (strain SK36) GN=rplO PE=3 SV=1 55 188 5.0E-25
sp|B1MVZ6|RL15_LEUCK 50S ribosomal protein L15 OS=Leuconostoc citreum (strain KM20) GN=rplO PE=3 SV=1 55 186 5.0E-25
sp|Q5LW38|RL15_RUEPO 50S ribosomal protein L15 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplO PE=3 SV=2 45 188 5.0E-25
sp|P0A0F7|RL15_STAAW 50S ribosomal protein L15 OS=Staphylococcus aureus (strain MW2) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|A8Z338|RL15_STAAT 50S ribosomal protein L15 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|Q6G790|RL15_STAAS 50S ribosomal protein L15 OS=Staphylococcus aureus (strain MSSA476) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|Q6GEK2|RL15_STAAR 50S ribosomal protein L15 OS=Staphylococcus aureus (strain MRSA252) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|P0A0F6|RL15_STAAN 50S ribosomal protein L15 OS=Staphylococcus aureus (strain N315) GN=rplO PE=1 SV=1 50 186 5.0E-25
sp|P0A0F5|RL15_STAAM 50S ribosomal protein L15 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|A6QJ73|RL15_STAAE 50S ribosomal protein L15 OS=Staphylococcus aureus (strain Newman) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|Q5HDX7|RL15_STAAC 50S ribosomal protein L15 OS=Staphylococcus aureus (strain COL) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|Q2YYL6|RL15_STAAB 50S ribosomal protein L15 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|A5IV15|RL15_STAA9 50S ribosomal protein L15 OS=Staphylococcus aureus (strain JH9) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|P0A0F8|RL15_STAA8 50S ribosomal protein L15 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplO PE=1 SV=1 50 186 5.0E-25
sp|Q2FEQ8|RL15_STAA3 50S ribosomal protein L15 OS=Staphylococcus aureus (strain USA300) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|A6U3V6|RL15_STAA2 50S ribosomal protein L15 OS=Staphylococcus aureus (strain JH1) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|A7X5D4|RL15_STAA1 50S ribosomal protein L15 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplO PE=3 SV=1 50 186 5.0E-25
sp|B7IT38|RL15_BACC2 50S ribosomal protein L15 OS=Bacillus cereus (strain G9842) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|A6LLN2|RL15_THEM4 50S ribosomal protein L15 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplO PE=3 SV=1 42 188 6.0E-25
sp|Q6HPN9|RL15_BACHK 50S ribosomal protein L15 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|Q63H71|RL15_BACCZ 50S ribosomal protein L15 OS=Bacillus cereus (strain ZK / E33L) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|B9IZL3|RL15_BACCQ 50S ribosomal protein L15 OS=Bacillus cereus (strain Q1) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|B7HQW3|RL15_BACC7 50S ribosomal protein L15 OS=Bacillus cereus (strain AH187) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|C1ET58|RL15_BACC3 50S ribosomal protein L15 OS=Bacillus cereus (strain 03BB102) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|Q73F77|RL15_BACC1 50S ribosomal protein L15 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|B7JKD8|RL15_BACC0 50S ribosomal protein L15 OS=Bacillus cereus (strain AH820) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|Q81VR1|RL15_BACAN 50S ribosomal protein L15 OS=Bacillus anthracis GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|A0R8J9|RL15_BACAH 50S ribosomal protein L15 OS=Bacillus thuringiensis (strain Al Hakam) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|C3LJA1|RL15_BACAC 50S ribosomal protein L15 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|C3P9S4|RL15_BACAA 50S ribosomal protein L15 OS=Bacillus anthracis (strain A0248) GN=rplO PE=3 SV=1 55 188 6.0E-25
sp|B9E9L0|RL15_MACCJ 50S ribosomal protein L15 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplO PE=3 SV=1 50 186 7.0E-25
sp|Q8ETW5|RL15_OCEIH 50S ribosomal protein L15 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplO PE=3 SV=1 42 187 7.0E-25
sp|A9NEF2|RL15_ACHLI 50S ribosomal protein L15 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplO PE=3 SV=1 41 188 8.0E-25
sp|Q8DS31|RL15_STRMU 50S ribosomal protein L15 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rplO PE=3 SV=1 50 188 8.0E-25
sp|Q11HS1|RL15_CHESB 50S ribosomal protein L15 OS=Chelativorans sp. (strain BNC1) GN=rplO PE=3 SV=1 42 188 9.0E-25
sp|Q16AC4|RL15_ROSDO 50S ribosomal protein L15 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplO PE=3 SV=1 42 186 1.0E-24
sp|Q211G7|RL15_RHOPB 50S ribosomal protein L15 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplO PE=3 SV=1 42 188 1.0E-24
sp|Q81J23|RL15_BACCR 50S ribosomal protein L15 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplO PE=3 SV=1 55 188 1.0E-24
sp|B7HJ67|RL15_BACC4 50S ribosomal protein L15 OS=Bacillus cereus (strain B4264) GN=rplO PE=3 SV=1 55 188 1.0E-24
sp|Q6FZE1|RL15_BARQU 50S ribosomal protein L15 OS=Bartonella quintana (strain Toulouse) GN=rplO PE=3 SV=1 42 190 1.0E-24
sp|Q6AP51|RL15_DESPS 50S ribosomal protein L15 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplO PE=3 SV=2 42 194 1.0E-24
sp|Q2N9D1|RL15_ERYLH 50S ribosomal protein L15 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplO PE=3 SV=1 42 188 1.0E-24
sp|B2GDV0|RL15_LACF3 50S ribosomal protein L15 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplO PE=3 SV=1 42 186 1.0E-24
sp|B2IK81|RL15_BEII9 50S ribosomal protein L15 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplO PE=3 SV=1 42 188 1.0E-24
sp|Q1RHP0|RL15_RICBR 50S ribosomal protein L15 OS=Rickettsia bellii (strain RML369-C) GN=rplO PE=3 SV=1 42 189 2.0E-24
sp|A8GVD3|RL15_RICB8 50S ribosomal protein L15 OS=Rickettsia bellii (strain OSU 85-389) GN=rplO PE=3 SV=1 42 189 2.0E-24
sp|A4IJK7|RL15_GEOTN 50S ribosomal protein L15 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rplO PE=3 SV=1 49 188 2.0E-24
sp|A4XLR2|RL15_CALS8 50S ribosomal protein L15 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rplO PE=3 SV=1 42 188 2.0E-24
sp|A7GK39|RL15_BACCN 50S ribosomal protein L15 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplO PE=3 SV=1 55 188 2.0E-24
sp|Q07KN7|RL15_RHOP5 50S ribosomal protein L15 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplO PE=3 SV=1 42 188 2.0E-24
sp|P35138|RL15_BACLD 50S ribosomal protein L15 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplO PE=3 SV=2 50 186 4.0E-24
sp|Q5M2D2|RL15_STRT2 50S ribosomal protein L15 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rplO PE=3 SV=2 55 188 6.0E-24
sp|Q5LXT0|RL15_STRT1 50S ribosomal protein L15 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rplO PE=3 SV=2 55 188 6.0E-24
sp|Q1GK09|RL15_RUEST 50S ribosomal protein L15 OS=Ruegeria sp. (strain TM1040) GN=rplO PE=3 SV=1 42 186 6.0E-24
sp|A8ZV76|RL15_DESOH 50S ribosomal protein L15 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplO PE=3 SV=1 42 188 6.0E-24
sp|B7GJ86|RL15_ANOFW 50S ribosomal protein L15 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rplO PE=3 SV=1 49 186 6.0E-24
sp|A8F9A4|RL15_BACP2 50S ribosomal protein L15 OS=Bacillus pumilus (strain SAFR-032) GN=rplO PE=3 SV=1 50 186 7.0E-24
sp|Q5WLP3|RL15_BACSK 50S ribosomal protein L15 OS=Bacillus clausii (strain KSM-K16) GN=rplO PE=3 SV=1 55 188 8.0E-24
sp|A7IPQ1|RL15_XANP2 50S ribosomal protein L15 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplO PE=3 SV=1 42 188 8.0E-24
sp|B0T2E1|RL15_CAUSK 50S ribosomal protein L15 OS=Caulobacter sp. (strain K31) GN=rplO PE=3 SV=1 42 196 1.0E-23
sp|Q03IH0|RL15_STRTD 50S ribosomal protein L15 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rplO PE=3 SV=1 55 188 1.0E-23
sp|Q839E5|RL15_ENTFA 50S ribosomal protein L15 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplO PE=3 SV=1 50 188 2.0E-23
sp|B7IHW5|RL15_THEAB 50S ribosomal protein L15 OS=Thermosipho africanus (strain TCF52B) GN=rplO PE=3 SV=1 42 187 2.0E-23
sp|B9JVQ6|RL15_AGRVS 50S ribosomal protein L15 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplO PE=3 SV=1 42 188 2.0E-23
sp|B1YGW9|RL15_EXIS2 50S ribosomal protein L15 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rplO PE=3 SV=1 50 188 2.0E-23
sp|A8MLF9|RL15_ALKOO 50S ribosomal protein L15 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplO PE=3 SV=1 50 188 2.0E-23
sp|A7HWT0|RL15_PARL1 50S ribosomal protein L15 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplO PE=3 SV=1 42 190 3.0E-23
sp|C0ME24|RL15_STRS7 50S ribosomal protein L15 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rplO PE=3 SV=1 55 188 3.0E-23
sp|B4U519|RL15_STREM 50S ribosomal protein L15 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rplO PE=3 SV=1 55 188 3.0E-23
sp|C0MBW6|RL15_STRE4 50S ribosomal protein L15 OS=Streptococcus equi subsp. equi (strain 4047) GN=rplO PE=3 SV=1 55 188 3.0E-23
sp|A8F4T0|RL15_PSELT 50S ribosomal protein L15 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplO PE=3 SV=1 42 188 3.0E-23
sp|P19946|RL15_BACSU 50S ribosomal protein L15 OS=Bacillus subtilis (strain 168) GN=rplO PE=1 SV=1 50 186 3.0E-23
sp|Q8E2B5|RL15_STRA5 50S ribosomal protein L15 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rplO PE=3 SV=1 55 188 4.0E-23
sp|Q8E7S2|RL15_STRA3 50S ribosomal protein L15 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rplO PE=3 SV=1 55 188 4.0E-23
sp|Q3K3V0|RL15_STRA1 50S ribosomal protein L15 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rplO PE=3 SV=1 55 188 4.0E-23
sp|B5XJ55|RL15_STRPZ 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|P0DE07|RL15_STRPQ 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|Q48VT0|RL15_STRPM 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|A2RC33|RL15_STRPG 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|Q1J8Z4|RL15_STRPF 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|Q1JJ43|RL15_STRPD 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|Q1JNZ8|RL15_STRPC 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|Q1JE40|RL15_STRPB 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|Q7CNP1|RL15_STRP8 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|Q5XEB6|RL15_STRP6 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|P0DE06|RL15_STRP3 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|Q9A1V5|RL15_STRP1 50S ribosomal protein L15 OS=Streptococcus pyogenes serotype M1 GN=rplO PE=3 SV=1 55 188 7.0E-23
sp|B9DSW9|RL15_STRU0 50S ribosomal protein L15 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rplO PE=3 SV=1 55 188 1.0E-22
sp|Q1GPB8|RL15_SPHAL 50S ribosomal protein L15 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplO PE=3 SV=1 42 188 2.0E-22
sp|A9H3K5|RL15_GLUDA 50S ribosomal protein L15 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplO PE=3 SV=1 42 191 3.0E-22
sp|Q9A8T4|RL15_CAUCR 50S ribosomal protein L15 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplO PE=3 SV=1 42 190 3.0E-22
sp|B8H4F3|RL15_CAUCN 50S ribosomal protein L15 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplO PE=3 SV=1 42 190 3.0E-22
sp|A3DJJ1|RL15_CLOTH 50S ribosomal protein L15 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rplO PE=3 SV=1 42 188 3.0E-22
sp|A0PXW5|RL15_CLONN 50S ribosomal protein L15 OS=Clostridium novyi (strain NT) GN=rplO PE=3 SV=1 56 187 3.0E-22
sp|Q8CRH9|RL15_STAES 50S ribosomal protein L15 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplO PE=3 SV=1 63 186 3.0E-22
sp|Q0AUJ9|RL15_SYNWW 50S ribosomal protein L15 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rplO PE=3 SV=1 50 188 3.0E-22
sp|C0ZIJ9|RL15_BREBN 50S ribosomal protein L15 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplO PE=3 SV=1 50 186 4.0E-22
sp|A7Z0Q7|RL15_BACMF 50S ribosomal protein L15 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplO PE=3 SV=1 55 186 4.0E-22
sp|Q68W97|RL15_RICTY 50S ribosomal protein L15 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplO PE=3 SV=1 42 189 4.0E-22
sp|Q89JA3|RL15_BRADU 50S ribosomal protein L15 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplO PE=3 SV=1 42 188 4.0E-22
sp|Q4L895|RL15_STAHJ 50S ribosomal protein L15 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplO PE=3 SV=1 64 186 5.0E-22
sp|Q38UT0|RL15_LACSS 50S ribosomal protein L15 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplO PE=3 SV=1 42 188 5.0E-22
sp|A5N4R6|RL15_CLOK5 50S ribosomal protein L15 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplO PE=3 SV=1 50 188 6.0E-22
sp|B9DYC8|RL15_CLOK1 50S ribosomal protein L15 OS=Clostridium kluyveri (strain NBRC 12016) GN=rplO PE=3 SV=1 50 188 6.0E-22
sp|A6LPT0|RL15_CLOB8 50S ribosomal protein L15 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplO PE=3 SV=1 56 188 6.0E-22
sp|C4ZBT7|RL15_EUBR3 50S ribosomal protein L15 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rplO PE=3 SV=1 42 188 7.0E-22
sp|Q5HM18|RL15_STAEQ 50S ribosomal protein L15 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplO PE=3 SV=1 63 186 7.0E-22
sp|B2A4F8|RL15_NATTJ 50S ribosomal protein L15 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplO PE=3 SV=1 54 188 7.0E-22
sp|Q9ZCS4|RL15_RICPR 50S ribosomal protein L15 OS=Rickettsia prowazekii (strain Madrid E) GN=rplO PE=3 SV=1 42 189 8.0E-22
sp|A9IW02|RL15_BART1 50S ribosomal protein L15 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rplO PE=3 SV=1 42 190 1.0E-21
sp|A4J130|RL15_DESRM 50S ribosomal protein L15 OS=Desulfotomaculum reducens (strain MI-1) GN=rplO PE=3 SV=1 42 187 1.0E-21
sp|B8ELE4|RL15_METSB 50S ribosomal protein L15 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplO PE=3 SV=1 42 188 1.0E-21
sp|Q2RFR6|RL15_MOOTA 50S ribosomal protein L15 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplO PE=3 SV=1 49 188 2.0E-21
sp|Q03PX6|RL15_LACBA 50S ribosomal protein L15 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplO PE=3 SV=1 42 158 2.0E-21
sp|B1HMW1|RL15_LYSSC 50S ribosomal protein L15 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplO PE=3 SV=1 50 186 2.0E-21
sp|Q0BYD3|RL15_HYPNA 50S ribosomal protein L15 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rplO PE=3 SV=1 42 199 3.0E-21
sp|B3QR90|RL15_CHLP8 50S ribosomal protein L15 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rplO PE=3 SV=1 42 194 3.0E-21
sp|Q8UE36|RL15_AGRFC 50S ribosomal protein L15 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplO PE=3 SV=1 42 185 7.0E-21
sp|B2UYC9|RL15_CLOBA 50S ribosomal protein L15 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rplO PE=3 SV=1 56 188 8.0E-21
sp|B2TIJ4|RL15_CLOBB 50S ribosomal protein L15 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rplO PE=3 SV=1 56 188 9.0E-21
sp|Q88XW7|RL15_LACPL 50S ribosomal protein L15 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplO PE=3 SV=1 42 188 1.0E-20
sp|Q2W2K9|RL15_MAGSA 50S ribosomal protein L15 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplO PE=3 SV=1 42 188 1.0E-20
sp|Q2G8W1|RL15_NOVAD 50S ribosomal protein L15 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplO PE=3 SV=2 42 189 1.0E-20
sp|A1USR3|RL15_BARBK 50S ribosomal protein L15 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rplO PE=3 SV=1 42 188 1.0E-20
sp|Q39XY7|RL15_GEOMG 50S ribosomal protein L15 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplO PE=3 SV=1 42 188 2.0E-20
sp|A5V5Y3|RL15_SPHWW 50S ribosomal protein L15 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplO PE=3 SV=1 42 188 3.0E-20
sp|Q046A7|RL15_LACGA 50S ribosomal protein L15 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplO PE=3 SV=1 42 188 3.0E-20
sp|B6IRS5|RL15_RHOCS 50S ribosomal protein L15 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplO PE=3 SV=1 42 158 4.0E-20
sp|C6E4N8|RL15_GEOSM 50S ribosomal protein L15 OS=Geobacter sp. (strain M21) GN=rplO PE=3 SV=1 50 188 5.0E-20
sp|B5EFR9|RL15_GEOBB 50S ribosomal protein L15 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rplO PE=3 SV=1 50 188 5.0E-20
sp|Q3A6M8|RL15_PELCD 50S ribosomal protein L15 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rplO PE=3 SV=1 42 188 9.0E-20
sp|Q890Q3|RL15_CLOTE 50S ribosomal protein L15 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplO PE=3 SV=1 50 188 1.0E-19
sp|Q02W44|RL15_LACLS 50S ribosomal protein L15 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplO PE=3 SV=1 55 158 1.0E-19
sp|A2RNN4|RL15_LACLM 50S ribosomal protein L15 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplO PE=3 SV=1 55 158 1.0E-19
sp|Q74L71|RL15_LACJO 50S ribosomal protein L15 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplO PE=3 SV=1 42 188 1.0E-19
sp|Q67JW2|RL15_SYMTH 50S ribosomal protein L15 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rplO PE=3 SV=1 42 188 1.0E-19
sp|Q6XYX0|RL15_SPIKU 50S ribosomal protein L15 OS=Spiroplasma kunkelii GN=rplO PE=3 SV=1 42 188 2.0E-19
sp|P58121|RL15_LACLA 50S ribosomal protein L15 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplO PE=3 SV=1 55 158 2.0E-19
sp|Q250L3|RL15_DESHY 50S ribosomal protein L15 OS=Desulfitobacterium hafniense (strain Y51) GN=rplO PE=3 SV=1 50 188 2.0E-19
sp|B8G1Y5|RL15_DESHD 50S ribosomal protein L15 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplO PE=3 SV=1 50 188 3.0E-19
sp|Q0ANR9|RL15_MARMM 50S ribosomal protein L15 OS=Maricaulis maris (strain MCS10) GN=rplO PE=3 SV=1 42 188 3.0E-19
sp|A9KJH5|RL15_CLOPH 50S ribosomal protein L15 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplO PE=3 SV=1 57 186 3.0E-19
sp|B4SBW6|RL15_PELPB 50S ribosomal protein L15 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rplO PE=3 SV=1 42 194 4.0E-19
sp|Q749A6|RL15_GEOSL 50S ribosomal protein L15 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rplO PE=3 SV=1 50 158 4.0E-19
sp|Q3A9T5|RL15_CARHZ 50S ribosomal protein L15 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplO PE=3 SV=1 42 188 5.0E-19
sp|B2UQM8|RL15_AKKM8 50S ribosomal protein L15 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rplO PE=3 SV=1 49 189 5.0E-19
sp|Q927M6|RL15_LISIN 50S ribosomal protein L15 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplO PE=3 SV=1 50 188 5.0E-19
sp|A0ALU9|RL15_LISW6 50S ribosomal protein L15 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplO PE=3 SV=1 50 188 6.0E-19
sp|Q8Y447|RL15_LISMO 50S ribosomal protein L15 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplO PE=3 SV=1 50 188 7.0E-19
sp|B8DB27|RL15_LISMH 50S ribosomal protein L15 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplO PE=3 SV=1 50 188 7.0E-19
sp|Q71WG5|RL15_LISMF 50S ribosomal protein L15 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplO PE=3 SV=1 50 188 7.0E-19
sp|C1KZG1|RL15_LISMC 50S ribosomal protein L15 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplO PE=3 SV=1 50 188 7.0E-19
sp|B8D0E2|RL15_HALOH 50S ribosomal protein L15 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplO PE=3 SV=1 58 188 7.0E-19
sp|A8YXM4|RL15_LACH4 50S ribosomal protein L15 OS=Lactobacillus helveticus (strain DPC 4571) GN=rplO PE=3 SV=1 45 188 8.0E-19
sp|Q5FM72|RL15_LACAC 50S ribosomal protein L15 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rplO PE=3 SV=1 42 188 1.0E-18
sp|B5YG29|RL15_THEYD 50S ribosomal protein L15 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rplO PE=3 SV=1 42 188 1.0E-18
sp|A6TWG3|RL15_ALKMQ 50S ribosomal protein L15 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rplO PE=3 SV=1 50 187 1.0E-18
sp|Q97EJ7|RL15_CLOAB 50S ribosomal protein L15 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rplO PE=3 SV=1 56 188 1.0E-18
sp|Q5NQ45|RL15_ZYMMO 50S ribosomal protein L15 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplO PE=3 SV=1 42 188 2.0E-18
sp|A5D5H4|RL15_PELTS 50S ribosomal protein L15 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rplO PE=3 SV=1 42 188 2.0E-18
sp|Q5FU02|RL15_GLUOX 50S ribosomal protein L15 OS=Gluconobacter oxydans (strain 621H) GN=rplO PE=3 SV=1 42 188 3.0E-18
sp|Q6DGM3|RM15_DANRE 39S ribosomal protein L15, mitochondrial OS=Danio rerio GN=mrpl15 PE=2 SV=1 42 258 3.0E-18
sp|A1ALW0|RL15_PELPD 50S ribosomal protein L15 OS=Pelobacter propionicus (strain DSM 2379) GN=rplO PE=3 SV=1 50 188 3.0E-18
sp|Q0SQG3|RL15_CLOPS 50S ribosomal protein L15 OS=Clostridium perfringens (strain SM101 / Type A) GN=rplO PE=3 SV=1 56 188 3.0E-18
sp|Q8XHU2|RL15_CLOPE 50S ribosomal protein L15 OS=Clostridium perfringens (strain 13 / Type A) GN=rplO PE=3 SV=1 56 188 3.0E-18
sp|Q0TMR5|RL15_CLOP1 50S ribosomal protein L15 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rplO PE=3 SV=1 56 188 3.0E-18
sp|O67561|RL15_AQUAE 50S ribosomal protein L15 OS=Aquifex aeolicus (strain VF5) GN=rplO PE=3 SV=1 42 187 3.0E-18
sp|A1BJ15|RL15_CHLPD 50S ribosomal protein L15 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rplO PE=3 SV=1 42 194 4.0E-18
sp|A5FZU6|RL15_ACICJ 50S ribosomal protein L15 OS=Acidiphilium cryptum (strain JF-5) GN=rplO PE=3 SV=1 42 190 4.0E-18
sp|Q8RIH5|RL15_FUSNN 50S ribosomal protein L15 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rplO PE=3 SV=1 54 188 5.0E-18
sp|Q0BUN1|RL15_GRABC 50S ribosomal protein L15 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplO PE=3 SV=1 42 197 5.0E-18
sp|B8FER6|RL15_DESAA 50S ribosomal protein L15 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplO PE=3 SV=1 42 188 8.0E-18
sp|Q18CH7|RL15_PEPD6 50S ribosomal protein L15 OS=Peptoclostridium difficile (strain 630) GN=rplO PE=3 SV=1 50 188 9.0E-18
sp|C1FMT2|RL15_CLOBJ 50S ribosomal protein L15 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplO PE=3 SV=1 50 188 1.0E-17
sp|A5I7I7|RL15_CLOBH 50S ribosomal protein L15 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplO PE=3 SV=1 50 188 1.0E-17
sp|C3KVN2|RL15_CLOB6 50S ribosomal protein L15 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplO PE=3 SV=1 50 188 1.0E-17
sp|A7FQ41|RL15_CLOB1 50S ribosomal protein L15 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplO PE=3 SV=1 50 188 1.0E-17
sp|B0RZS8|RL15_FINM2 50S ribosomal protein L15 OS=Finegoldia magna (strain ATCC 29328) GN=rplO PE=3 SV=1 50 188 1.0E-17
sp|B4U763|RL15_HYDS0 50S ribosomal protein L15 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rplO PE=3 SV=1 51 188 1.0E-17
sp|B4S5A9|RL15_PROA2 50S ribosomal protein L15 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rplO PE=3 SV=1 42 230 1.0E-17
sp|Q04BZ6|RL15_LACDB 50S ribosomal protein L15 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rplO PE=3 SV=1 42 188 1.0E-17
sp|Q1GBJ9|RL15_LACDA 50S ribosomal protein L15 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rplO PE=3 SV=1 42 188 1.0E-17
sp|B1IGD5|RL15_CLOBK 50S ribosomal protein L15 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplO PE=3 SV=1 50 188 1.0E-17
sp|A8F2C8|RL15_RICM5 50S ribosomal protein L15 OS=Rickettsia massiliae (strain Mtu5) GN=rplO PE=3 SV=1 42 189 1.0E-17
sp|Q73PL3|RL15_TREDE 50S ribosomal protein L15 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplO PE=3 SV=1 44 189 1.0E-17
sp|Q3APJ2|RL15_CHLCH 50S ribosomal protein L15 OS=Chlorobium chlorochromatii (strain CaD3) GN=rplO PE=3 SV=1 42 194 1.0E-17
sp|Q3SSU7|RL15_NITWN 50S ribosomal protein L15 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplO PE=3 SV=1 42 188 1.0E-17
sp|C5CGI3|RL15_KOSOT 50S ribosomal protein L15 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplO PE=3 SV=1 42 187 2.0E-17
sp|Q37M24|RL15_RHOPS 50S ribosomal protein L15 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplO PE=3 SV=1 42 188 2.0E-17
sp|A9B430|RL15_HERA2 50S ribosomal protein L15 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rplO PE=3 SV=1 42 188 2.0E-17
sp|P10138|RL15_MYCCT 50S ribosomal protein L15 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rplO PE=3 SV=1 42 188 3.0E-17
sp|B3QBW1|RL15_RHOPT 50S ribosomal protein L15 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplO PE=3 SV=1 42 188 3.0E-17
sp|Q6N4V2|RL15_RHOPA 50S ribosomal protein L15 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplO PE=1 SV=1 42 188 3.0E-17
sp|B1KSK6|RL15_CLOBM 50S ribosomal protein L15 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplO PE=3 SV=1 50 188 3.0E-17
sp|A7GJ55|RL15_CLOBL 50S ribosomal protein L15 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rplO PE=3 SV=1 50 188 3.0E-17
sp|B3EP42|RL15_CHLPB 50S ribosomal protein L15 OS=Chlorobium phaeobacteroides (strain BS1) GN=rplO PE=3 SV=1 42 201 3.0E-17
sp|B3R010|RL15_PHYMT 50S ribosomal protein L15 OS=Phytoplasma mali (strain AT) GN=rplO PE=3 SV=1 50 188 3.0E-17
sp|Q3B6E3|RL15_CHLL7 50S ribosomal protein L15 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rplO PE=3 SV=1 42 194 4.0E-17
sp|Q7NEH0|RL15_GLOVI 50S ribosomal protein L15 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplO PE=3 SV=1 50 186 5.0E-17
sp|A8GPD1|RL15_RICAH 50S ribosomal protein L15 OS=Rickettsia akari (strain Hartford) GN=rplO PE=3 SV=1 42 189 6.0E-17
sp|B3PMM9|RL15_MYCA5 50S ribosomal protein L15 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rplO PE=3 SV=1 42 189 6.0E-17
sp|Q6MSP3|RL15_MYCMS 50S ribosomal protein L15 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rplO PE=3 SV=1 42 188 7.0E-17
sp|A5IYW8|RL15_MYCAP 50S ribosomal protein L15 OS=Mycoplasma agalactiae (strain PG2) GN=rplO PE=3 SV=1 42 189 8.0E-17
sp|Q2IXP1|RL15_RHOP2 50S ribosomal protein L15 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplO PE=3 SV=1 42 188 1.0E-16
sp|Q04G67|RL15_OENOB 50S ribosomal protein L15 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rplO PE=3 SV=1 42 189 1.0E-16
sp|Q4UMR0|RL15_RICFE 50S ribosomal protein L15 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplO PE=3 SV=1 42 189 1.0E-16
sp|B8I7Z8|RL15_CLOCE 50S ribosomal protein L15 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rplO PE=3 SV=1 49 188 1.0E-16
sp|A0L5Z2|RL15_MAGMM 50S ribosomal protein L15 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplO PE=3 SV=1 49 189 2.0E-16
sp|A8GT50|RL15_RICRS 50S ribosomal protein L15 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplO PE=3 SV=1 42 189 2.0E-16
sp|B0BUP1|RL15_RICRO 50S ribosomal protein L15 OS=Rickettsia rickettsii (strain Iowa) GN=rplO PE=3 SV=1 42 189 2.0E-16
sp|B1VAC9|RL15_PHYAS 50S ribosomal protein L15 OS=Phytoplasma australiense GN=rplO PE=3 SV=1 56 188 2.0E-16
sp|Q1QN11|RL15_NITHX 50S ribosomal protein L15 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplO PE=3 SV=1 42 188 2.0E-16
sp|Q01WB1|RL15_SOLUE 50S ribosomal protein L15 OS=Solibacter usitatus (strain Ellin6076) GN=rplO PE=3 SV=1 50 186 3.0E-16
sp|B5Y969|RL15_COPPD 50S ribosomal protein L15 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rplO PE=3 SV=1 42 188 3.0E-16
sp|Q8KAJ0|RL15_CHLTE 50S ribosomal protein L15 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rplO PE=3 SV=1 42 194 3.0E-16
sp|Q4A5D9|RL15_MYCS5 50S ribosomal protein L15 OS=Mycoplasma synoviae (strain 53) GN=rplO PE=3 SV=2 42 188 4.0E-16
sp|Q9XD17|RL15_LEPIN 50S ribosomal protein L15 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rplO PE=3 SV=1 50 197 4.0E-16
sp|Q72NI0|RL15_LEPIC 50S ribosomal protein L15 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rplO PE=3 SV=1 50 197 4.0E-16
sp|A5GAW1|RL15_GEOUR 50S ribosomal protein L15 OS=Geobacter uraniireducens (strain Rf4) GN=rplO PE=3 SV=1 42 188 4.0E-16
sp|C4K2G0|RL15_RICPU 50S ribosomal protein L15 OS=Rickettsia peacockii (strain Rustic) GN=rplO PE=3 SV=1 42 189 5.0E-16
sp|B9M6F9|RL15_GEODF 50S ribosomal protein L15 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplO PE=3 SV=1 42 188 5.0E-16
sp|B3QYE3|RL15_CHLT3 50S ribosomal protein L15 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rplO PE=3 SV=1 42 194 6.0E-16
sp|Q92GY5|RL15_RICCN 50S ribosomal protein L15 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplO PE=3 SV=1 42 189 7.0E-16
sp|C3PP88|RL15_RICAE 50S ribosomal protein L15 OS=Rickettsia africae (strain ESF-5) GN=rplO PE=3 SV=1 42 189 7.0E-16
sp|Q98Q00|RL15_MYCPU 50S ribosomal protein L15 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rplO PE=3 SV=1 42 188 7.0E-16
sp|B3PK56|RL15_CELJU 50S ribosomal protein L15 OS=Cellvibrio japonicus (strain Ueda107) GN=rplO PE=3 SV=1 42 188 7.0E-16
sp|Q3Z962|RL15_DEHM1 50S ribosomal protein L15 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rplO PE=3 SV=1 42 188 7.0E-16
sp|Q2NIX3|RL15_AYWBP 50S ribosomal protein L15 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rplO PE=3 SV=1 56 188 9.0E-16
sp|B2V7J4|RL15_SULSY 50S ribosomal protein L15 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rplO PE=3 SV=1 42 186 1.0E-15
sp|Q5QXW4|RL15_IDILO 50S ribosomal protein L15 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplO PE=3 SV=1 42 188 1.0E-15
sp|Q3ZZQ5|RL15_DEHMC 50S ribosomal protein L15 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rplO PE=3 SV=1 42 188 1.0E-15
sp|A5FRW3|RL15_DEHMB 50S ribosomal protein L15 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rplO PE=3 SV=1 42 188 1.0E-15
sp|A9ADL2|RL15_BURM1 50S ribosomal protein L15 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rplO PE=3 SV=1 42 186 3.0E-15
sp|B3E0K2|RL15_METI4 50S ribosomal protein L15 OS=Methylacidiphilum infernorum (isolate V4) GN=rplO PE=3 SV=1 41 188 3.0E-15
sp|B1I1L8|RL15_DESAP 50S ribosomal protein L15 OS=Desulforudis audaxviator (strain MP104C) GN=rplO PE=3 SV=1 42 188 3.0E-15
sp|B0TC75|RL15_HELMI 50S ribosomal protein L15 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplO PE=3 SV=1 42 188 4.0E-15
sp|Q04PV7|RL15_LEPBJ 50S ribosomal protein L15 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rplO PE=3 SV=1 34 197 5.0E-15
sp|Q39KE8|RL15_BURL3 50S ribosomal protein L15 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rplO PE=3 SV=1 42 186 7.0E-15
sp|A0K3P4|RL15_BURCH 50S ribosomal protein L15 OS=Burkholderia cenocepacia (strain HI2424) GN=rplO PE=3 SV=1 42 186 7.0E-15
sp|B1JU41|RL15_BURCC 50S ribosomal protein L15 OS=Burkholderia cenocepacia (strain MC0-3) GN=rplO PE=3 SV=1 42 186 7.0E-15
sp|Q1BRW7|RL15_BURCA 50S ribosomal protein L15 OS=Burkholderia cenocepacia (strain AU 1054) GN=rplO PE=3 SV=1 42 186 7.0E-15
sp|Q2IJ68|RL15_ANADE 50S ribosomal protein L15 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplO PE=3 SV=1 50 188 8.0E-15
sp|Q6AZN4|RM15_XENLA 39S ribosomal protein L15, mitochondrial OS=Xenopus laevis GN=mrpl15 PE=2 SV=1 11 258 8.0E-15
sp|Q6KI37|RL15_MYCMO 50S ribosomal protein L15 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rplO PE=3 SV=1 42 188 1.0E-14
sp|Q4A8I9|RL15_MYCH7 50S ribosomal protein L15 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rplO PE=3 SV=2 42 191 1.0E-14
sp|Q2SU46|RL15_BURTA 50S ribosomal protein L15 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rplO PE=3 SV=1 42 186 2.0E-14
sp|A8EZJ7|RL15_RICCK 50S ribosomal protein L15 OS=Rickettsia canadensis (strain McKiel) GN=rplO PE=3 SV=1 42 189 2.0E-14
sp|Q13TI9|RL15_BURXL 50S ribosomal protein L15 OS=Burkholderia xenovorans (strain LB400) GN=rplO PE=3 SV=1 42 186 2.0E-14
sp|Q15X54|RL15_PSEA6 50S ribosomal protein L15 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplO PE=3 SV=1 42 188 2.0E-14
sp|A4JAQ9|RL15_BURVG 50S ribosomal protein L15 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rplO PE=3 SV=1 42 186 2.0E-14
sp|Q0BJ27|RL15_BURCM 50S ribosomal protein L15 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rplO PE=3 SV=1 42 186 2.0E-14
sp|B4E5D9|RL15_BURCJ 50S ribosomal protein L15 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rplO PE=3 SV=1 42 186 2.0E-14
sp|B1YRP8|RL15_BURA4 50S ribosomal protein L15 OS=Burkholderia ambifaria (strain MC40-6) GN=rplO PE=3 SV=1 42 186 2.0E-14
sp|Q89A84|RL15_BUCBP 50S ribosomal protein L15 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplO PE=3 SV=1 56 188 2.0E-14
sp|A1T0C3|RL15_PSYIN 50S ribosomal protein L15 OS=Psychromonas ingrahamii (strain 37) GN=rplO PE=3 SV=1 42 188 2.0E-14
sp|Q1D756|RL15_MYXXD 50S ribosomal protein L15 OS=Myxococcus xanthus (strain DK 1622) GN=rplO PE=3 SV=1 53 188 2.0E-14
sp|B4UBB8|RL15_ANASK 50S ribosomal protein L15 OS=Anaeromyxobacter sp. (strain K) GN=rplO PE=3 SV=1 50 188 3.0E-14
sp|B8J879|RL15_ANAD2 50S ribosomal protein L15 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplO PE=3 SV=1 50 188 3.0E-14
sp|B3E849|RL15_GEOLS 50S ribosomal protein L15 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rplO PE=3 SV=1 50 188 3.0E-14
sp|Q601J6|RL15_MYCH2 50S ribosomal protein L15 OS=Mycoplasma hyopneumoniae (strain 232) GN=rplO PE=3 SV=1 42 191 3.0E-14
sp|Q63Q30|RL15_BURPS 50S ribosomal protein L15 OS=Burkholderia pseudomallei (strain K96243) GN=rplO PE=3 SV=1 42 186 3.0E-14
sp|A3NEG0|RL15_BURP6 50S ribosomal protein L15 OS=Burkholderia pseudomallei (strain 668) GN=rplO PE=3 SV=1 42 186 3.0E-14
sp|Q3JMT2|RL15_BURP1 50S ribosomal protein L15 OS=Burkholderia pseudomallei (strain 1710b) GN=rplO PE=3 SV=1 42 186 3.0E-14
sp|A3P094|RL15_BURP0 50S ribosomal protein L15 OS=Burkholderia pseudomallei (strain 1106a) GN=rplO PE=3 SV=1 42 186 3.0E-14
sp|A1V884|RL15_BURMS 50S ribosomal protein L15 OS=Burkholderia mallei (strain SAVP1) GN=rplO PE=3 SV=1 42 186 3.0E-14
sp|Q62GM4|RL15_BURMA 50S ribosomal protein L15 OS=Burkholderia mallei (strain ATCC 23344) GN=rplO PE=3 SV=1 42 186 3.0E-14
sp|A2S7J5|RL15_BURM9 50S ribosomal protein L15 OS=Burkholderia mallei (strain NCTC 10229) GN=rplO PE=3 SV=1 42 186 3.0E-14
sp|A3MRX3|RL15_BURM7 50S ribosomal protein L15 OS=Burkholderia mallei (strain NCTC 10247) GN=rplO PE=3 SV=1 42 186 3.0E-14
sp|B2JI46|RL15_BURP8 50S ribosomal protein L15 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rplO PE=3 SV=1 42 186 4.0E-14
sp|A1VE97|RL15_DESVV 50S ribosomal protein L15 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rplO PE=3 SV=1 55 186 5.0E-14
sp|Q72CG1|RL15_DESVH 50S ribosomal protein L15 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rplO PE=3 SV=1 55 186 5.0E-14
sp|Q65QX4|RL15_MANSM 50S ribosomal protein L15 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplO PE=3 SV=1 42 188 5.0E-14
sp|Q493J0|RL15_BLOPB 50S ribosomal protein L15 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplO PE=3 SV=1 42 188 6.0E-14
sp|Q7VKF2|RL15_HAEDU 50S ribosomal protein L15 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplO PE=3 SV=1 42 188 7.0E-14
sp|B3GZ30|RL15_ACTP7 50S ribosomal protein L15 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplO PE=3 SV=1 42 188 8.0E-14
sp|Q1LTB9|RL15_BAUCH 50S ribosomal protein L15 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplO PE=3 SV=1 42 188 8.0E-14
sp|Q4AAF8|RL15_MYCHJ 50S ribosomal protein L15 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rplO PE=3 SV=2 42 191 9.0E-14
sp|A0M579|RL15_GRAFK 50S ribosomal protein L15 OS=Gramella forsetii (strain KT0803) GN=rplO PE=3 SV=1 42 190 1.0E-13
sp|Q4FLN6|RL15_PELUB 50S ribosomal protein L15 OS=Pelagibacter ubique (strain HTCC1062) GN=rplO PE=3 SV=1 55 188 1.0E-13
sp|A9BFZ9|RL15_PETMO 50S ribosomal protein L15 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rplO PE=3 SV=1 44 188 2.0E-13
sp|A4G9R9|RL15_HERAR 50S ribosomal protein L15 OS=Herminiimonas arsenicoxydans GN=rplO PE=3 SV=1 50 188 2.0E-13
sp|Q110C4|RL15_TRIEI 50S ribosomal protein L15 OS=Trichodesmium erythraeum (strain IMS101) GN=rplO PE=3 SV=1 50 186 2.0E-13
sp|A6T3I5|RL15_JANMA 50S ribosomal protein L15 OS=Janthinobacterium sp. (strain Marseille) GN=rplO PE=3 SV=1 50 188 2.0E-13
sp|A7HBN7|RL15_ANADF 50S ribosomal protein L15 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplO PE=3 SV=1 50 188 2.0E-13
sp|Q5HAU0|RL15_EHRRW 50S ribosomal protein L15 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rplO PE=3 SV=1 56 158 2.0E-13
sp|Q0VC21|RM15_BOVIN 39S ribosomal protein L15, mitochondrial OS=Bos taurus GN=MRPL15 PE=1 SV=1 76 258 2.0E-13
sp|Q7UN02|RL15_RHOBA 50S ribosomal protein L15 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rplO PE=3 SV=1 55 186 2.0E-13
sp|Q87SZ4|RL15_VIBPA 50S ribosomal protein L15 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplO PE=3 SV=1 42 188 3.0E-13
sp|Q2NQP1|RL15_SODGM 50S ribosomal protein L15 OS=Sodalis glossinidius (strain morsitans) GN=rplO PE=3 SV=1 42 188 3.0E-13
sp|Q1IX91|RL15_DEIGD 50S ribosomal protein L15 OS=Deinococcus geothermalis (strain DSM 11300) GN=rplO PE=3 SV=1 42 189 3.0E-13
sp|B2T732|RL15_BURPP 50S ribosomal protein L15 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rplO PE=3 SV=1 42 186 4.0E-13
sp|B0BSV0|RL15_ACTPJ 50S ribosomal protein L15 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|A3N376|RL15_ACTP2 50S ribosomal protein L15 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|Q6F1X6|RL15_MESFL 50S ribosomal protein L15 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplO PE=3 SV=1 57 188 4.0E-13
sp|B1JIY0|RL15_YERPY 50S ribosomal protein L15 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|Q664U0|RL15_YERPS 50S ribosomal protein L15 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|A4TH10|RL15_YERPP 50S ribosomal protein L15 OS=Yersinia pestis (strain Pestoides F) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|Q1CCW3|RL15_YERPN 50S ribosomal protein L15 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|A9R913|RL15_YERPG 50S ribosomal protein L15 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|Q8ZJ93|RL15_YERPE 50S ribosomal protein L15 OS=Yersinia pestis GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|B2K518|RL15_YERPB 50S ribosomal protein L15 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|Q1C2W6|RL15_YERPA 50S ribosomal protein L15 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|A7FNL5|RL15_YERP3 50S ribosomal protein L15 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|A1JS08|RL15_YERE8 50S ribosomal protein L15 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|B9KZW9|RL15_THERP 50S ribosomal protein L15 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rplO PE=3 SV=1 42 188 4.0E-13
sp|Q1R0F6|RL15_CHRSD 50S ribosomal protein L15 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplO PE=3 SV=1 42 119 4.0E-13
sp|P44353|RL15_HAEIN 50S ribosomal protein L15 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplO PE=3 SV=1 42 188 5.0E-13
sp|A5UDS8|RL15_HAEIE 50S ribosomal protein L15 OS=Haemophilus influenzae (strain PittEE) GN=rplO PE=3 SV=1 42 188 5.0E-13
sp|B5ELZ8|RL15_ACIF5 50S ribosomal protein L15 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rplO PE=3 SV=1 42 188 5.0E-13
sp|B7J486|RL15_ACIF2 50S ribosomal protein L15 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rplO PE=3 SV=1 42 188 5.0E-13
sp|Q5FFR6|RL15_EHRRG 50S ribosomal protein L15 OS=Ehrlichia ruminantium (strain Gardel) GN=rplO PE=3 SV=1 56 158 7.0E-13
sp|A5UHV0|RL15_HAEIG 50S ribosomal protein L15 OS=Haemophilus influenzae (strain PittGG) GN=rplO PE=3 SV=1 42 188 7.0E-13
sp|A7MWH7|RL15_VIBCB 50S ribosomal protein L15 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplO PE=3 SV=1 42 188 7.0E-13
sp|O52350|RL15_MYCGA 50S ribosomal protein L15 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rplO PE=3 SV=2 53 188 7.0E-13
sp|B7KI04|RL15_CYAP7 50S ribosomal protein L15 OS=Cyanothece sp. (strain PCC 7424) GN=rplO PE=3 SV=1 42 189 7.0E-13
sp|Q9CPR5|RM15_MOUSE 39S ribosomal protein L15, mitochondrial OS=Mus musculus GN=Mrpl15 PE=1 SV=1 76 266 7.0E-13
sp|B3R7E9|RL15_CUPTR 50S ribosomal protein L15 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplO PE=3 SV=1 42 158 9.0E-13
sp|B2S2F5|RL15_TREPS 50S ribosomal protein L15 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rplO PE=3 SV=1 50 188 9.0E-13
sp|O83237|RL15_TREPA 50S ribosomal protein L15 OS=Treponema pallidum (strain Nichols) GN=rplO PE=3 SV=1 50 188 9.0E-13
sp|Q9CL49|RL15_PASMU 50S ribosomal protein L15 OS=Pasteurella multocida (strain Pm70) GN=rplO PE=3 SV=1 42 188 1.0E-12
sp|Q1IFU7|RL15_PSEE4 50S ribosomal protein L15 OS=Pseudomonas entomophila (strain L48) GN=rplO PE=3 SV=1 42 187 1.0E-12
sp|Q1LI56|RL15_CUPMC 50S ribosomal protein L15 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplO PE=3 SV=1 42 158 1.0E-12
sp|P46185|RL15_BUCAK 50S ribosomal protein L15 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rplO PE=3 SV=1 42 188 1.0E-12
sp|B2ITN8|RL15_NOSP7 50S ribosomal protein L15 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rplO PE=3 SV=1 50 186 1.0E-12
sp|C5BQ80|RL15_TERTT 50S ribosomal protein L15 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplO PE=3 SV=1 42 188 1.0E-12
sp|Q0I086|RL15_SHESR 50S ribosomal protein L15 OS=Shewanella sp. (strain MR-7) GN=rplO PE=3 SV=1 42 188 1.0E-12
sp|Q0HNR8|RL15_SHESM 50S ribosomal protein L15 OS=Shewanella sp. (strain MR-4) GN=rplO PE=3 SV=1 42 188 1.0E-12
sp|A0KRP3|RL15_SHESA 50S ribosomal protein L15 OS=Shewanella sp. (strain ANA-3) GN=rplO PE=3 SV=1 42 188 1.0E-12
sp|Q8EK51|RL15_SHEON 50S ribosomal protein L15 OS=Shewanella oneidensis (strain MR-1) GN=rplO PE=3 SV=1 42 188 1.0E-12
sp|Q6NJ83|RL15_CORDI 50S ribosomal protein L15 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rplO PE=3 SV=1 42 188 1.0E-12
sp|B8F6Q2|RL15_HAEPS 50S ribosomal protein L15 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplO PE=3 SV=1 42 188 2.0E-12
sp|A1SNJ9|RL15_NOCSJ 50S ribosomal protein L15 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rplO PE=3 SV=1 42 186 2.0E-12
sp|A6VLK7|RL15_ACTSZ 50S ribosomal protein L15 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplO PE=3 SV=1 42 188 2.0E-12
sp|C4LL07|RL15_CORK4 50S ribosomal protein L15 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rplO PE=3 SV=1 42 189 2.0E-12
sp|Q7MPG9|RL15_VIBVY 50S ribosomal protein L15 OS=Vibrio vulnificus (strain YJ016) GN=rplO PE=3 SV=1 42 188 2.0E-12
sp|Q8DE59|RL15_VIBVU 50S ribosomal protein L15 OS=Vibrio vulnificus (strain CMCP6) GN=rplO PE=3 SV=1 42 188 2.0E-12
sp|Q0K638|RL15_CUPNH 50S ribosomal protein L15 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplO PE=3 SV=1 42 158 2.0E-12
sp|A8GKH8|RL15_SERP5 50S ribosomal protein L15 OS=Serratia proteamaculans (strain 568) GN=rplO PE=3 SV=1 42 188 2.0E-12
sp|C5BGK6|RL15_EDWI9 50S ribosomal protein L15 OS=Edwardsiella ictaluri (strain 93-146) GN=rplO PE=3 SV=1 42 188 2.0E-12
sp|Q2GH38|RL15_EHRCR 50S ribosomal protein L15 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rplO PE=3 SV=1 56 158 2.0E-12
sp|Q7MYH0|RL15_PHOLL 50S ribosomal protein L15 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplO PE=3 SV=1 42 188 2.0E-12
sp|A1A088|RL15_BIFAA 50S ribosomal protein L15 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rplO PE=3 SV=1 44 188 3.0E-12
sp|A5F561|RL15_VIBC3 50S ribosomal protein L15 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplO PE=3 SV=1 41 188 3.0E-12
sp|Q12G84|RL15_POLSJ 50S ribosomal protein L15 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rplO PE=3 SV=1 50 189 3.0E-12
sp|B0UX33|RL15_HISS2 50S ribosomal protein L15 OS=Histophilus somni (strain 2336) GN=rplO PE=3 SV=1 42 188 3.0E-12
sp|Q0I143|RL15_HAES1 50S ribosomal protein L15 OS=Haemophilus somnus (strain 129Pt) GN=rplO PE=3 SV=1 42 188 3.0E-12
sp|Q3YRM7|RL15_EHRCJ 50S ribosomal protein L15 OS=Ehrlichia canis (strain Jake) GN=rplO PE=3 SV=1 56 158 3.0E-12
sp|Q4QMA2|RL15_HAEI8 50S ribosomal protein L15 OS=Haemophilus influenzae (strain 86-028NP) GN=rplO PE=3 SV=1 42 188 3.0E-12
sp|Q3J8T2|RL15_NITOC 50S ribosomal protein L15 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplO PE=3 SV=1 42 188 4.0E-12
sp|Q5ZKT8|RM15_CHICK 39S ribosomal protein L15, mitochondrial OS=Gallus gallus GN=MRPL15 PE=2 SV=1 76 266 4.0E-12
sp|C3LRN9|RL15_VIBCM 50S ribosomal protein L15 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplO PE=3 SV=1 41 188 4.0E-12
sp|Q9KP03|RL15_VIBCH 50S ribosomal protein L15 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplO PE=3 SV=1 41 188 4.0E-12
sp|B1VEX4|RL15_CORU7 50S ribosomal protein L15 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rplO PE=3 SV=1 50 188 4.0E-12
sp|A1VJ34|RL15_POLNA 50S ribosomal protein L15 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rplO PE=3 SV=1 50 188 4.0E-12
sp|A1RED3|RL15_SHESW 50S ribosomal protein L15 OS=Shewanella sp. (strain W3-18-1) GN=rplO PE=3 SV=1 42 188 4.0E-12
sp|A4YBW4|RL15_SHEPC 50S ribosomal protein L15 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplO PE=3 SV=1 42 188 4.0E-12
sp|A9KWC1|RL15_SHEB9 50S ribosomal protein L15 OS=Shewanella baltica (strain OS195) GN=rplO PE=3 SV=1 42 188 4.0E-12
sp|A6WHU7|RL15_SHEB8 50S ribosomal protein L15 OS=Shewanella baltica (strain OS185) GN=rplO PE=3 SV=1 42 188 4.0E-12
sp|A3DA53|RL15_SHEB5 50S ribosomal protein L15 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplO PE=3 SV=1 42 188 4.0E-12
sp|B8EBI6|RL15_SHEB2 50S ribosomal protein L15 OS=Shewanella baltica (strain OS223) GN=rplO PE=3 SV=1 42 188 4.0E-12
sp|Q1ISA3|RL15_KORVE 50S ribosomal protein L15 OS=Koribacter versatilis (strain Ellin345) GN=rplO PE=3 SV=1 42 188 4.0E-12
sp|C4XLZ2|RL15_DESMR 50S ribosomal protein L15 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rplO PE=3 SV=1 54 190 4.0E-12
sp|Q46WG3|RL15_CUPPJ 50S ribosomal protein L15 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rplO PE=3 SV=1 42 158 5.0E-12
sp|Q4K552|RL15_PSEF5 50S ribosomal protein L15 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplO PE=3 SV=1 42 187 6.0E-12
sp|Q4ZMR3|RL15_PSEU2 50S ribosomal protein L15 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplO PE=3 SV=1 42 187 6.0E-12
sp|Q889V2|RL15_PSESM 50S ribosomal protein L15 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplO PE=3 SV=1 42 187 6.0E-12
sp|Q48D55|RL15_PSE14 50S ribosomal protein L15 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplO PE=3 SV=1 42 187 6.0E-12
sp|B7VLD8|RL15_VIBTL 50S ribosomal protein L15 OS=Vibrio tasmaniensis (strain LGP32) GN=rplO PE=3 SV=1 42 188 7.0E-12
sp|A4XBM7|RL15_SALTO 50S ribosomal protein L15 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rplO PE=3 SV=1 49 189 7.0E-12
sp|P33101|RL15_MICLU 50S ribosomal protein L15 OS=Micrococcus luteus GN=rplO PE=3 SV=1 44 190 7.0E-12
sp|C5CC44|RL15_MICLC 50S ribosomal protein L15 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rplO PE=3 SV=1 44 190 7.0E-12
sp|Q6LV97|RL15_PHOPR 50S ribosomal protein L15 OS=Photobacterium profundum GN=rplO PE=3 SV=1 42 188 8.0E-12
sp|Q9P015|RM15_HUMAN 39S ribosomal protein L15, mitochondrial OS=Homo sapiens GN=MRPL15 PE=1 SV=1 76 258 8.0E-12
sp|B3DQD3|RL15_BIFLD 50S ribosomal protein L15 OS=Bifidobacterium longum (strain DJO10A) GN=rplO PE=3 SV=1 44 188 9.0E-12
sp|A4XZ71|RL15_PSEMY 50S ribosomal protein L15 OS=Pseudomonas mendocina (strain ymp) GN=rplO PE=3 SV=1 42 187 1.0E-11
sp|Q4JT88|RL15_CORJK 50S ribosomal protein L15 OS=Corynebacterium jeikeium (strain K411) GN=rplO PE=3 SV=1 42 189 1.0E-11
sp|B8GV39|RL15_THISH 50S ribosomal protein L15 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplO PE=3 SV=1 42 188 1.0E-11
sp|C1F623|RL15_ACIC5 50S ribosomal protein L15 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rplO PE=3 SV=1 42 189 1.0E-11
sp|Q82X73|RL15_NITEU 50S ribosomal protein L15 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplO PE=3 SV=1 50 188 1.0E-11
sp|B4F1K3|RL15_PROMH 50S ribosomal protein L15 OS=Proteus mirabilis (strain HI4320) GN=rplO PE=3 SV=1 42 188 1.0E-11
sp|B2VK77|RL15_ERWT9 50S ribosomal protein L15 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplO PE=3 SV=1 42 188 1.0E-11
sp|C4K799|RL15_HAMD5 50S ribosomal protein L15 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplO PE=3 SV=1 42 188 1.0E-11
sp|B1JAJ3|RL15_PSEPW 50S ribosomal protein L15 OS=Pseudomonas putida (strain W619) GN=rplO PE=3 SV=1 42 187 2.0E-11
sp|Q88QL6|RL15_PSEPK 50S ribosomal protein L15 OS=Pseudomonas putida (strain KT2440) GN=rplO PE=3 SV=1 42 187 2.0E-11
sp|B0KK86|RL15_PSEPG 50S ribosomal protein L15 OS=Pseudomonas putida (strain GB-1) GN=rplO PE=3 SV=1 42 187 2.0E-11
sp|A5VXR6|RL15_PSEP1 50S ribosomal protein L15 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplO PE=3 SV=1 42 187 2.0E-11
sp|B6EPU4|RL15_ALISL 50S ribosomal protein L15 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplO PE=3 SV=1 42 188 2.0E-11
sp|C6DG55|RL15_PECCP 50S ribosomal protein L15 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplO PE=3 SV=1 42 188 2.0E-11
sp|Q6AD13|RL15_LEIXX 50S ribosomal protein L15 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rplO PE=3 SV=1 50 188 2.0E-11
sp|Q6MJ31|RL15_BDEBA 50S ribosomal protein L15 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rplO PE=3 SV=1 40 188 2.0E-11
sp|Q6A6P5|RL15_PROAC 50S ribosomal protein L15 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rplO PE=3 SV=1 42 191 2.0E-11
sp|A8M510|RL15_SALAI 50S ribosomal protein L15 OS=Salinispora arenicola (strain CNS-205) GN=rplO PE=3 SV=1 49 186 2.0E-11
sp|Q21M39|RL15_SACD2 50S ribosomal protein L15 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplO PE=3 SV=1 42 120 2.0E-11
sp|A1KRJ2|RL15_NEIMF 50S ribosomal protein L15 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplO PE=3 SV=1 50 188 2.0E-11
sp|Q9K1I2|RL15_NEIMB 50S ribosomal protein L15 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplO PE=3 SV=1 50 188 2.0E-11
sp|A9M3U7|RL15_NEIM0 50S ribosomal protein L15 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplO PE=3 SV=1 50 188 2.0E-11
sp|B7GNC1|RL15_BIFLS 50S ribosomal protein L15 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rplO PE=3 SV=1 44 188 3.0E-11
sp|Q8G400|RL15_BIFLO 50S ribosomal protein L15 OS=Bifidobacterium longum (strain NCC 2705) GN=rplO PE=3 SV=1 44 188 3.0E-11
sp|Q5GSW2|RL15_WOLTR 50S ribosomal protein L15 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rplO PE=3 SV=1 56 188 3.0E-11
sp|P0C544|RL15_CORGL 50S ribosomal protein L15 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rplO PE=3 SV=1 48 186 3.0E-11
sp|A4QBL6|RL15_CORGB 50S ribosomal protein L15 OS=Corynebacterium glutamicum (strain R) GN=rplO PE=3 SV=1 48 186 3.0E-11
sp|Q488Z4|RL15_COLP3 50S ribosomal protein L15 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplO PE=3 SV=1 42 188 3.0E-11
sp|B5FGD5|RL15_VIBFM 50S ribosomal protein L15 OS=Vibrio fischeri (strain MJ11) GN=rplO PE=3 SV=1 42 188 3.0E-11
sp|Q5E895|RL15_VIBF1 50S ribosomal protein L15 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplO PE=3 SV=2 42 188 3.0E-11
sp|Q5N0U8|RL15_SYNP6 50S ribosomal protein L15 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|P31160|RL15_SYNE7 50S ribosomal protein L15 OS=Synechococcus elongatus (strain PCC 7942) GN=rplO PE=3 SV=2 42 188 4.0E-11
sp|Q3YWV8|RL15_SHISS 50S ribosomal protein L15 OS=Shigella sonnei (strain Ss046) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|P66075|RL15_SHIFL 50S ribosomal protein L15 OS=Shigella flexneri GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|Q0T001|RL15_SHIF8 50S ribosomal protein L15 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|Q32B50|RL15_SHIDS 50S ribosomal protein L15 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|Q31VX5|RL15_SHIBS 50S ribosomal protein L15 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|B2U2R9|RL15_SHIB3 50S ribosomal protein L15 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|P66073|RL15_SALTY 50S ribosomal protein L15 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|P66074|RL15_SALTI 50S ribosomal protein L15 OS=Salmonella typhi GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|B4TXC3|RL15_SALSV 50S ribosomal protein L15 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|B5BGW7|RL15_SALPK 50S ribosomal protein L15 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|C0PZW4|RL15_SALPC 50S ribosomal protein L15 OS=Salmonella paratyphi C (strain RKS4594) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|A9MSX9|RL15_SALPB 50S ribosomal protein L15 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|Q5PK03|RL15_SALPA 50S ribosomal protein L15 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|B4SUS1|RL15_SALNS 50S ribosomal protein L15 OS=Salmonella newport (strain SL254) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|B4TJZ0|RL15_SALHS 50S ribosomal protein L15 OS=Salmonella heidelberg (strain SL476) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|B5RH34|RL15_SALG2 50S ribosomal protein L15 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|B5R1F8|RL15_SALEP 50S ribosomal protein L15 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|B5FJJ5|RL15_SALDC 50S ribosomal protein L15 OS=Salmonella dublin (strain CT_02021853) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|Q57J51|RL15_SALCH 50S ribosomal protein L15 OS=Salmonella choleraesuis (strain SC-B67) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|B5F7S6|RL15_SALA4 50S ribosomal protein L15 OS=Salmonella agona (strain SL483) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|B7LRR7|RL15_ESCF3 50S ribosomal protein L15 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplO PE=3 SV=1 42 188 4.0E-11
sp|Q1R630|RL15_ECOUT 50S ribosomal protein L15 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplO PE=3 SV=1 42 188 4.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|841
MPRRLPVTSILHCRGHIGSSASSLTACLSGLLLQQTRQASILGNLADRPGAIHNKKRVGRGPSSGHGKTAGRGNH
GQKQHGKVRPWFQGGQTPLWKQVGTKGFINVRAPQMSEVNLEQIQHWINQGRLDANKQITPKELIECGIVGSVKD
GVKILARGADRFKYKINVMVSRVSARAIEAIEAKGGRVVTRYYTKLAIQNLLAGKSVNTELPLPVGKEHVKKIVS
QARKTGFKSRLPDPTSREDIEYYRDPAHRGYLSRQLKPGESPSLYFKVPKVRKAKKTAKVKTETMW*
Coding >OphauG2|841
ATGCCTCGGCGGCTACCAGTAACAAGCATATTGCACTGCAGAGGCCATATTGGATCATCAGCCAGCTCATTGACA
GCATGCCTATCAGGCCTCTTGCTTCAACAGACGCGACAAGCCTCGATTCTAGGCAACTTGGCCGACAGACCAGGA
GCAATACACAACAAGAAGCGCGTTGGGCGTGGACCGTCCTCGGGACATGGAAAGACAGCTGGCAGAGGTAATCAC
GGACAAAAACAGCACGGCAAAGTGCGGCCATGGTTCCAGGGTGGACAGACACCATTATGGAAGCAGGTTGGCACC
AAGGGATTCATCAACGTGCGAGCACCTCAGATGTCCGAAGTCAACTTGGAGCAAATCCAACACTGGATTAACCAG
GGACGACTCGACGCAAATAAGCAAATCACGCCCAAGGAGCTGATTGAATGCGGCATAGTGGGATCAGTCAAGGAC
GGGGTCAAGATCCTGGCCCGCGGGGCAGACAGGTTCAAATATAAAATCAACGTCATGGTGTCGCGGGTTTCAGCA
CGGGCGATTGAGGCGATTGAGGCCAAGGGGGGCCGGGTGGTTACGCGCTACTACACCAAGTTGGCCATACAGAAT
CTGTTGGCGGGAAAGTCAGTCAACACGGAGCTGCCGCTGCCGGTAGGCAAGGAGCATGTCAAGAAGATTGTTAGC
CAGGCGCGCAAGACGGGCTTCAAGTCGCGGCTGCCGGACCCGACGAGCCGCGAGGACATTGAGTACTATCGTGAT
CCGGCGCACCGAGGCTACCTAAGCCGGCAACTCAAGCCCGGCGAGTCACCAAGCTTGTACTTCAAGGTGCCCAAA
GTGCGCAAGGCCAAGAAGACGGCCAAGGTCAAGACGGAAACCATGTGGTGA
Transcript >OphauG2|841
ATGCCTCGGCGGCTACCAGTAACAAGCATATTGCACTGCAGAGGCCATATTGGATCATCAGCCAGCTCATTGACA
GCATGCCTATCAGGCCTCTTGCTTCAACAGACGCGACAAGCCTCGATTCTAGGCAACTTGGCCGACAGACCAGGA
GCAATACACAACAAGAAGCGCGTTGGGCGTGGACCGTCCTCGGGACATGGAAAGACAGCTGGCAGAGGTAATCAC
GGACAAAAACAGCACGGCAAAGTGCGGCCATGGTTCCAGGGTGGACAGACACCATTATGGAAGCAGGTTGGCACC
AAGGGATTCATCAACGTGCGAGCACCTCAGATGTCCGAAGTCAACTTGGAGCAAATCCAACACTGGATTAACCAG
GGACGACTCGACGCAAATAAGCAAATCACGCCCAAGGAGCTGATTGAATGCGGCATAGTGGGATCAGTCAAGGAC
GGGGTCAAGATCCTGGCCCGCGGGGCAGACAGGTTCAAATATAAAATCAACGTCATGGTGTCGCGGGTTTCAGCA
CGGGCGATTGAGGCGATTGAGGCCAAGGGGGGCCGGGTGGTTACGCGCTACTACACCAAGTTGGCCATACAGAAT
CTGTTGGCGGGAAAGTCAGTCAACACGGAGCTGCCGCTGCCGGTAGGCAAGGAGCATGTCAAGAAGATTGTTAGC
CAGGCGCGCAAGACGGGCTTCAAGTCGCGGCTGCCGGACCCGACGAGCCGCGAGGACATTGAGTACTATCGTGAT
CCGGCGCACCGAGGCTACCTAAGCCGGCAACTCAAGCCCGGCGAGTCACCAAGCTTGTACTTCAAGGTGCCCAAA
GTGCGCAAGGCCAAGAAGACGGCCAAGGTCAAGACGGAAACCATGTGGTGA
Gene >OphauG2|841
ATGCCTCGGCGGCTACCAGTAACAAGCATATTGCACTGCAGAGGCCATATTGGATCATCAGCCAGCTCATTGACA
GCATGCCTATCAGGCCTCTTGCTTCAACAGACGCGACAAGCCTCGATTCTAGGCAACTTGGCCGACAGACCAGGA
GCAATACACAACAAGAAGCGCGTTGGGCGTGGACCGTCCTCGGGACATGGAAAGACAGCTGGCAGAGGTAATCAC
GGACAAAAACAGCACGGCAAAGTGCGGCCATGGTTCCAGGGTGGACAGACACCATTATGGAAGCAGGTTGGCACC
AAGGGATTCATCAACGTGTGAGTAGTCCTGAAACAAGGCGGCTCAAGACAGCTGCTTACGGCAGAGGCGGACAGG
CGAGCACCTCAGATGTCCGAAGTCAACTTGGAGCAAATCCAACACTGGATTAACCAGGGACGACTCGACGCAAAT
AAGCAAATCACGCCCAAGGAGCTGATTGAATGCGGCATAGTGGGATCAGTCAAGGACGGGGTCAAGATCCTGGCC
CGCGGGGCAGACAGGTTCAAATATAAAATCAACGTCATGGTGTCGCGGGTTTCAGCACGGGCGATTGAGGCGATT
GAGGCCAAGGGGGGCCGGGTGGTTACGCGCTACTACACCAAGTTGGCCATACAGAATCTGTTGGCGGGAAAGTCA
GTCAACACGGAGCTGCCGCTGCCGGTAGGCAAGGAGCATGTCAAGAAGATTGTTAGCCAGGCGCGCAAGACGGGC
TTCAAGTCGCGGCTGCCGGACCCGACGAGCCGCGAGGACATTGAGTACTATCGTGATCCGGCGCACCGAGGCTAC
CTAAGCCGGCAACTCAAGCCCGGCGAGTCACCAAGCTTGTACTTCAAGGTGCCCAAAGTGCGCAAGGCCAAGAAG
ACGGCCAAGGTCAAGACGGAAACCATGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail