Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|833
Gene name
LocationContig_1216:84..1464
Strand+
Gene length (bp)1380
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1 4.1E-32 311 395

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13684|PCS1_SCHPO Monopolin complex subunit pcs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcs1 PE=1 SV=4 295 409 2.0E-13

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6183
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|833 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4959
Ophiocordyceps camponoti-rufipedis Ophun1|978
Ophiocordyceps kimflemingae Ophio5|8247
Ophiocordyceps subramaniannii Hirsu2|5596

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|833
MAPQVKKSGRLANLAASDSEPNLDGRNEPAVRGRRTGRGRGSSSVGRVTKASSTRSRRKVGRNAGGSGRTLEDKD
ESNDTINDAVHGRGKQGADVHPDLVQDDGPVASKTGRRKAGKSVRERNEVLLAQEEADSPDELSVLNVEADATDS
GIARPEAGSTSLRRRLGELTRRYDNLTTRHGELRDVGVKAAERNFERFKKQVQESAAVSDKLIAQLKEEVAAQAS
LASQGEQVQREFELSRANSSQLQSQIDQLGIALSAARSEVETLSAKLAASRSAAESQAAKIPGSALKPGSTANRI
LQSTELLQAAQAKEDLYGDLTGLLVRGLKRDQSEEVFDCIQTGQNGTLHFKLLLQRGDNYEDAQFTYRPQLDEDR
DGALIKVLPDYLLEEITFLRSQASKFYSRVTKSLTERIQ*
Coding >OphauG2|833
ATGGCACCACAGGTTAAAAAATCAGGCCGCCTAGCGAATCTGGCTGCATCAGACTCGGAACCTAATTTGGACGGT
CGCAATGAGCCGGCAGTTAGAGGACGACGGACCGGGCGAGGTCGAGGTTCGAGCAGTGTTGGCAGAGTTACCAAA
GCCTCTTCTACAAGATCGCGTCGAAAGGTGGGCCGGAATGCCGGGGGCTCTGGACGGACCTTGGAGGACAAGGAC
GAGTCCAATGACACAATAAATGATGCTGTACATGGGCGCGGTAAACAAGGGGCAGATGTACACCCGGATTTGGTA
CAAGACGATGGGCCTGTCGCGTCGAAAACAGGGCGGCGAAAGGCTGGAAAAAGCGTCAGGGAGAGAAATGAAGTT
TTACTTGCTCAGGAGGAAGCCGACAGTCCAGATGAATTGTCGGTGCTCAACGTCGAGGCAGATGCCACGGATAGC
GGAATCGCCCGCCCGGAGGCTGGCAGCACTTCGCTTCGCAGGCGCCTCGGGGAGCTCACAAGAAGATATGACAAC
CTCACAACACGCCATGGGGAGCTACGAGACGTGGGCGTCAAGGCAGCTGAACGCAACTTTGAACGCTTCAAGAAG
CAAGTTCAAGAAAGTGCAGCAGTATCGGACAAGCTCATTGCCCAACTGAAAGAAGAGGTGGCAGCACAGGCCAGT
CTTGCCAGCCAAGGCGAGCAGGTACAGCGCGAGTTTGAGCTCAGTCGAGCCAACAGCAGCCAGCTCCAGAGCCAA
ATAGACCAGCTCGGCATTGCGCTCTCGGCAGCTCGCTCGGAAGTCGAGACGCTGTCTGCCAAACTGGCCGCCAGT
AGAAGCGCAGCCGAGAGTCAGGCTGCCAAGATTCCCGGCAGCGCTCTCAAACCCGGGTCGACGGCAAATCGCATC
CTCCAGTCCACGGAGCTTCTTCAAGCAGCCCAGGCAAAGGAAGACCTGTACGGCGACTTGACAGGACTGCTCGTC
AGGGGCCTGAAGCGCGATCAAAGTGAGGAAGTCTTTGACTGCATCCAGACTGGCCAAAACGGCACGTTACATTTC
AAATTATTGCTCCAACGCGGCGACAACTACGAAGATGCCCAGTTTACCTATCGGCCGCAGCTGGACGAGGATCGT
GATGGTGCTCTAATCAAGGTGCTGCCCGACTATCTGCTTGAAGAGATTACCTTTCTGCGATCACAGGCATCCAAA
TTCTATAGCAGAGTAACAAAATCACTGACGGAGCGTATTCAATAA
Transcript >OphauG2|833
ATGGCACCACAGGTTAAAAAATCAGGCCGCCTAGCGAATCTGGCTGCATCAGACTCGGAACCTAATTTGGACGGT
CGCAATGAGCCGGCAGTTAGAGGACGACGGACCGGGCGAGGTCGAGGTTCGAGCAGTGTTGGCAGAGTTACCAAA
GCCTCTTCTACAAGATCGCGTCGAAAGGTGGGCCGGAATGCCGGGGGCTCTGGACGGACCTTGGAGGACAAGGAC
GAGTCCAATGACACAATAAATGATGCTGTACATGGGCGCGGTAAACAAGGGGCAGATGTACACCCGGATTTGGTA
CAAGACGATGGGCCTGTCGCGTCGAAAACAGGGCGGCGAAAGGCTGGAAAAAGCGTCAGGGAGAGAAATGAAGTT
TTACTTGCTCAGGAGGAAGCCGACAGTCCAGATGAATTGTCGGTGCTCAACGTCGAGGCAGATGCCACGGATAGC
GGAATCGCCCGCCCGGAGGCTGGCAGCACTTCGCTTCGCAGGCGCCTCGGGGAGCTCACAAGAAGATATGACAAC
CTCACAACACGCCATGGGGAGCTACGAGACGTGGGCGTCAAGGCAGCTGAACGCAACTTTGAACGCTTCAAGAAG
CAAGTTCAAGAAAGTGCAGCAGTATCGGACAAGCTCATTGCCCAACTGAAAGAAGAGGTGGCAGCACAGGCCAGT
CTTGCCAGCCAAGGCGAGCAGGTACAGCGCGAGTTTGAGCTCAGTCGAGCCAACAGCAGCCAGCTCCAGAGCCAA
ATAGACCAGCTCGGCATTGCGCTCTCGGCAGCTCGCTCGGAAGTCGAGACGCTGTCTGCCAAACTGGCCGCCAGT
AGAAGCGCAGCCGAGAGTCAGGCTGCCAAGATTCCCGGCAGCGCTCTCAAACCCGGGTCGACGGCAAATCGCATC
CTCCAGTCCACGGAGCTTCTTCAAGCAGCCCAGGCAAAGGAAGACCTGTACGGCGACTTGACAGGACTGCTCGTC
AGGGGCCTGAAGCGCGATCAAAGTGAGGAAGTCTTTGACTGCATCCAGACTGGCCAAAACGGCACGTTACATTTC
AAATTATTGCTCCAACGCGGCGACAACTACGAAGATGCCCAGTTTACCTATCGGCCGCAGCTGGACGAGGATCGT
GATGGTGCTCTAATCAAGGTGCTGCCCGACTATCTGCTTGAAGAGATTACCTTTCTGCGATCACAGGCATCCAAA
TTCTATAGCAGAGTAACAAAATCACTGACGGAGCGTATTCAATAA
Gene >OphauG2|833
ATGGCACCACAGGTTAAAAAATCAGGCCGCCTAGCGAATCTGGCTGCATCAGACTCGGAACCTAATTTGGACGGT
CGCAATGAGCCGGCAGTTAGAGGACGACGGACCGGGCGAGGTCGAGGTTCGAGCAGTGTTGGCAGAGTTACCAAA
GCCTCTTCTACAAGATCGCGTCGAAAGGTGGGCCGGAATGCCGGGGGCTCTGGACGGACCTTGGAGGACAAGGAC
GAGTCCAATGACACAATAAATGATGCTGTACATGGGCGCGGTAAACAAGGGGCAGATGTACACCCGGATTTGGTA
CAAGACGATGGGCCTGTCGCGTCGAAAACAGGGCGGCGAAAGGCTGGAAAAAGCGTCAGGGAGAGAAATGAAGTT
TTACTTGCTCAGGAGGAAGCCGACAGTCCAGATGAATTGTCGGTGCTCAACGTCGAGGCAGATGCCACGGATAGC
GGAATCGCCCGCCCGGAGGCTGGCAGCACTTCGCTTCGCAGGCGCCTCGGGGAGCTCACAAGAAGATATGACAAC
CTCACAACACGCCATGGGGAGCTACGAGACGTGGGCGTCAAGGCAGCTGAACGCAACTTTGAACGCTTCAAGAAG
CAAGTTCAAGAAAGTGCAGCAGGTAGGAGAAACGGTAGCACAAGCTCAAAGCGCGTCCCAAGCTTGACTGACAGC
GGTATTGATGCAGTATCGGACAAGCTCATTGCCCAACTGAAAGAAGAGGTGGCAGCACAGGCCAGTCTTGCCAGC
CAAGGCGAGCAGGTACAGCGCGAGTTTGAGCTCAGTCGAGCCAACAGCAGCCAGCTCCAGAGCCAAATAGACCAG
CTCGGCATTGCGCTCTCGGCAGCTCGCTCGGAAGTCGAGACGCTGTCTGCCAAACTGGCCGCCAGTAGAAGCGCA
GCCGAGAGTCAGGCTGCCAAGATTCCCGGCAGCGCTCTCAAACCCGGGTCGACGGCAAATCGCATCCTCCAGTCC
ACGGAGCTTCTTCAAGCAGCCCAGGCAAAGGAAGACCTGTACGGCGACTTGACAGGACTGCTCGTCAGGGGCCTG
AAGCGCGATCAAAGTGAGGAAGTCTTTGACTGCATCCAGACTGGCCAAAACGGCAGTAAGTCGTGCCCTTGAATC
GCCAATACACACTGCTCGCAAGCACAACTGATGGCCTGGATTTGAATAGCGTTACATTTCAAATTATTGCTCCAA
CGCGGCGACAACTACGAAGATGCCCAGTTTACCTATCGGCCGCAGCTGGACGAGGATCGTGATGGTGCTCTAATC
AAGGTGCTGCCCGACTATCTGCTTGAAGAGATTACCTTTCTGCGATCACAGGCATCCAAATTCTATAGCAGAGTA
ACAAAATCACTGACGGAGCGTATTCAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail