Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|825
Gene name
LocationContig_1212:125..938
Strand+
Gene length (bp)813
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 8.7E-08 172 207
PF16278 zf-C2HE C2HE / C2H2 / C2HC zinc-binding finger 4.2E-14 212 266
PF01230 HIT HIT domain 2.0E-11 50 197

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74859|APTX_SCHPO Aprataxin-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hnt3 PE=1 SV=1 25 267 1.0E-28
sp|Q08702|APTX_YEAST Aprataxin-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT3 PE=1 SV=1 36 265 1.0E-24
sp|Q558W0|Y2839_DICDI HIT domain-containing protein DDB_G0272839 OS=Dictyostelium discoideum GN=DDB_G0272839 PE=2 SV=1 27 222 1.0E-12
sp|P61802|APTX_CIOIN Aprataxin OS=Ciona intestinalis GN=APTX PE=2 SV=1 7 262 1.0E-11
sp|P61800|APTX_TAKRU Aprataxin OS=Takifugu rubripes GN=aptx PE=2 SV=1 176 264 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74859|APTX_SCHPO Aprataxin-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hnt3 PE=1 SV=1 25 267 1.0E-28
sp|Q08702|APTX_YEAST Aprataxin-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNT3 PE=1 SV=1 36 265 1.0E-24
sp|Q558W0|Y2839_DICDI HIT domain-containing protein DDB_G0272839 OS=Dictyostelium discoideum GN=DDB_G0272839 PE=2 SV=1 27 222 1.0E-12
sp|P61802|APTX_CIOIN Aprataxin OS=Ciona intestinalis GN=APTX PE=2 SV=1 7 262 1.0E-11
sp|P61800|APTX_TAKRU Aprataxin OS=Takifugu rubripes GN=aptx PE=2 SV=1 176 264 3.0E-11
sp|Q9M041|BH140_ARATH Transcription factor bHLH140 OS=Arabidopsis thaliana GN=BHLH140 PE=3 SV=1 132 216 7.0E-10
sp|P61799|APTX_DANRE Aprataxin OS=Danio rerio GN=aptx PE=2 SV=1 176 264 2.0E-09
sp|P61798|APTX_CHICK Aprataxin (Fragment) OS=Gallus gallus GN=APTX PE=2 SV=1 172 260 3.0E-09
sp|P61801|APTX_XENTR Aprataxin OS=Xenopus tropicalis GN=aptx PE=2 SV=1 50 217 6.0E-09
sp|Q7T287|APTX_XENLA Aprataxin OS=Xenopus laevis GN=aptx PE=2 SV=1 172 217 2.0E-08
sp|P61797|APTX_CANLF Aprataxin OS=Canis lupus familiaris GN=APTX PE=2 SV=1 176 217 4.0E-08
sp|Q7Z2E3|APTX_HUMAN Aprataxin OS=Homo sapiens GN=APTX PE=1 SV=2 176 217 4.0E-08
sp|Q7TQC5|APTX_MOUSE Aprataxin OS=Mus musculus GN=Aptx PE=1 SV=2 176 217 4.0E-08
sp|Q7YRZ1|APTX_PIG Aprataxin OS=Sus scrofa GN=APTX PE=2 SV=1 176 217 5.0E-08
sp|Q7YRZ2|APTX_BOVIN Aprataxin OS=Bos taurus GN=APTX PE=2 SV=1 176 217 5.0E-08
sp|Q9BGQ0|APTX_MACFA Aprataxin OS=Macaca fascicularis GN=APTX PE=2 SV=1 176 217 5.0E-08
sp|Q8K4H4|APTX_RAT Aprataxin OS=Rattus norvegicus GN=Aptx PE=2 SV=1 176 217 6.0E-08
sp|Q8MSG8|APTX_DROME Aprataxin-like protein OS=Drosophila melanogaster GN=CG5316 PE=2 SV=2 167 245 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|825
MATEAEPEPAEAEQPSQPASSSTGPSHAQRPSFKDRMALGAYIADPGAYPGAVIFHDADFVAVRDLFPKATVHAL
LLPRWPLDALLQRPLDVLANDGELLARLRVAAERLRGLVAAQLAREVGRWSEADSRRQAVLDGRESEAGEAEGEG
QGEREKEGPGDVPRLPRGRDWAAEVRCGLHLVPSMRHLHVHVISRDMHSASLRHRKHYNSFTTPFFVALHQLPLP
PADPRRSAHHLARDLVCWRCGRNFGNRFRRLKEHLDAEFDEWKRE*
Coding >OphauG2|825
ATGGCGACCGAGGCAGAGCCCGAGCCAGCAGAGGCCGAGCAGCCCAGCCAGCCAGCCTCGTCCAGCACCGGCCCC
AGCCACGCACAGCGGCCCTCGTTCAAGGACCGCATGGCGCTGGGCGCCTACATTGCCGACCCGGGCGCGTACCCC
GGCGCGGTGATTTTCCACGACGCCGACTTTGTGGCGGTGCGCGACCTGTTTCCCAAGGCCACGGTGCACGCGCTG
CTGCTGCCGCGGTGGCCGCTCGATGCGCTGCTGCAGCGCCCGCTGGACGTGCTGGCCAACGACGGCGAGCTGCTG
GCCCGCCTGCGGGTTGCGGCGGAGCGGCTGCGCGGCCTGGTGGCGGCACAGCTGGCGAGGGAGGTGGGCAGATGG
AGCGAGGCGGATAGCAGGCGCCAGGCGGTGCTTGACGGGCGGGAGTCTGAAGCTGGCGAGGCAGAAGGAGAGGGA
CAAGGAGAGCGAGAGAAAGAGGGACCAGGAGACGTGCCGCGTCTGCCGCGAGGACGCGACTGGGCCGCCGAGGTG
CGCTGCGGCCTGCACCTCGTGCCCAGCATGCGCCATCTCCACGTCCACGTCATCTCGCGCGACATGCACTCGGCC
TCGCTGCGCCACCGCAAGCACTACAACTCCTTCACCACGCCCTTTTTCGTCGCCTTGCACCAGCTGCCCCTGCCG
CCCGCCGACCCGCGCCGCTCGGCGCACCATCTTGCCCGCGACTTGGTGTGCTGGCGCTGCGGCCGCAACTTTGGG
AACCGCTTCCGCCGCCTCAAGGAGCACCTGGATGCCGAGTTTGACGAGTGGAAGCGCGAGTAA
Transcript >OphauG2|825
ATGGCGACCGAGGCAGAGCCCGAGCCAGCAGAGGCCGAGCAGCCCAGCCAGCCAGCCTCGTCCAGCACCGGCCCC
AGCCACGCACAGCGGCCCTCGTTCAAGGACCGCATGGCGCTGGGCGCCTACATTGCCGACCCGGGCGCGTACCCC
GGCGCGGTGATTTTCCACGACGCCGACTTTGTGGCGGTGCGCGACCTGTTTCCCAAGGCCACGGTGCACGCGCTG
CTGCTGCCGCGGTGGCCGCTCGATGCGCTGCTGCAGCGCCCGCTGGACGTGCTGGCCAACGACGGCGAGCTGCTG
GCCCGCCTGCGGGTTGCGGCGGAGCGGCTGCGCGGCCTGGTGGCGGCACAGCTGGCGAGGGAGGTGGGCAGATGG
AGCGAGGCGGATAGCAGGCGCCAGGCGGTGCTTGACGGGCGGGAGTCTGAAGCTGGCGAGGCAGAAGGAGAGGGA
CAAGGAGAGCGAGAGAAAGAGGGACCAGGAGACGTGCCGCGTCTGCCGCGAGGACGCGACTGGGCCGCCGAGGTG
CGCTGCGGCCTGCACCTCGTGCCCAGCATGCGCCATCTCCACGTCCACGTCATCTCGCGCGACATGCACTCGGCC
TCGCTGCGCCACCGCAAGCACTACAACTCCTTCACCACGCCCTTTTTCGTCGCCTTGCACCAGCTGCCCCTGCCG
CCCGCCGACCCGCGCCGCTCGGCGCACCATCTTGCCCGCGACTTGGTGTGCTGGCGCTGCGGCCGCAACTTTGGG
AACCGCTTCCGCCGCCTCAAGGAGCACCTGGATGCCGAGTTTGACGAGTGGAAGCGCGAGTAA
Gene >OphauG2|825
ATGGCGACCGAGGCAGAGCCCGAGCCAGCAGAGGCCGAGCAGCCCAGCCAGCCAGCCTCGTCCAGCACCGGCCCC
AGCCACGCACAGCGGCCCTCGTTCAAGGACCGCATGGCGCTGGGCGCCTACATTGCCGACCCGGGCGCGTACCCC
GGCGCGGTGATTTTCCACGACGCCGACTTTGTGGCGGTGCGCGACCTGTTTCCCAAGGCCACGGTGCACGCGCTG
CTGCTGCCGCGGTGGCCGCTCGATGCGCTGCTGCAGCGCCCGCTGGACGTGCTGGCCAACGACGGCGAGCTGCTG
GCCCGCCTGCGGGTTGCGGCGGAGCGGCTGCGCGGCCTGGTGGCGGCACAGCTGGCGAGGGAGGTGGGCAGATGG
AGCGAGGCGGATAGCAGGCGCCAGGCGGTGCTTGACGGGCGGGAGTCTGAAGCTGGCGAGGCAGAAGGAGAGGGA
CAAGGAGAGCGAGAGAAAGAGGGACCAGGAGACGTGCCGCGTCTGCCGCGAGGACGCGACTGGGCCGCCGAGGTG
CGCTGCGGCCTGCACCTCGTGCCCAGCATGCGCCATCTCCACGTCCACGTCATCTCGCGCGACATGCACTCGGCC
TCGCTGCGCCACCGCAAGCACTACAACTCCTTCACCACGCCCTTTTTCGTCGCCTTGCACCAGCTGCCCCTGCCG
CCCGCCGACCCGCGCCGCTCGGCGCACCATCTTGCCCGCGACTTGGTGTGCTGGCGCTGCGGCCGCAACTTTGGG
AACCGCTTCCGCCGCCTCAAGGAGCACCTGGATGCCGAGTTTGACGAGTGGAAGCGCGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail