Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7976
Gene name
LocationContig_991:3503..6619
Strand-
Gene length (bp)3116
Transcript length (bp)2805
Coding sequence length (bp)2805
Protein length (aa) 935

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17786 Mannosidase_ig Mannosidase Ig/CBM-like domain 1.9E-13 745 840
PF17753 Ig_mannosidase Ig-fold domain 5.0E-11 847 929
PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2 4.9E-07 266 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UN00|MANBA_ASPOR Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mndA PE=3 SV=1 1 932 0.0E+00
sp|B8NP78|MANBA_ASPFN Beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mndA PE=3 SV=1 8 932 0.0E+00
sp|A2QWU9|MANBA_ASPNC Beta-mannosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mndA PE=3 SV=1 25 932 0.0E+00
sp|A1DMT2|MANBA_NEOFI Beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mndA PE=3 SV=1 5 932 0.0E+00
sp|B0Y7S2|MANBA_ASPFC Beta-mannosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mndA PE=3 SV=1 5 932 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UN00|MANBA_ASPOR Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mndA PE=3 SV=1 1 932 0.0E+00
sp|B8NP78|MANBA_ASPFN Beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mndA PE=3 SV=1 8 932 0.0E+00
sp|A2QWU9|MANBA_ASPNC Beta-mannosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mndA PE=3 SV=1 25 932 0.0E+00
sp|A1DMT2|MANBA_NEOFI Beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mndA PE=3 SV=1 5 932 0.0E+00
sp|B0Y7S2|MANBA_ASPFC Beta-mannosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mndA PE=3 SV=1 5 932 0.0E+00
sp|Q4WMS9|MANBA_ASPFU Beta-mannosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mndA PE=3 SV=1 5 932 0.0E+00
sp|A1CTM5|MANBA_ASPCL Beta-mannosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mndA PE=3 SV=1 1 932 0.0E+00
sp|Q5BCI8|MANBA_EMENI Beta-mannosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mndA PE=3 SV=1 22 934 0.0E+00
sp|Q9UUZ3|MANBA_ASPNG Beta-mannosidase A OS=Aspergillus niger GN=mndA PE=1 SV=1 25 932 0.0E+00
sp|O74168|MANBA_ASPAC Beta-mannosidase A OS=Aspergillus aculeatus GN=mndA PE=1 SV=1 25 634 0.0E+00
sp|Q0CI48|MANBA_ASPTN Beta-mannosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mndA PE=3 SV=2 22 934 0.0E+00
sp|Q4FZV0|MANBA_RAT Beta-mannosidase OS=Rattus norvegicus GN=Manba PE=2 SV=1 31 899 2.0E-110
sp|O00462|MANBA_HUMAN Beta-mannosidase OS=Homo sapiens GN=MANBA PE=2 SV=3 31 895 5.0E-109
sp|Q8K2I4|MANBA_MOUSE Beta-mannosidase OS=Mus musculus GN=Manba PE=1 SV=1 31 899 6.0E-108
sp|Q95327|MANBA_CAPHI Beta-mannosidase OS=Capra hircus GN=MANBA PE=2 SV=1 31 895 4.0E-104
sp|Q29444|MANBA_BOVIN Beta-mannosidase OS=Bos taurus GN=MANBA PE=1 SV=1 31 895 4.0E-102
sp|Q2TXB7|MANBB_ASPOR Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mndB PE=3 SV=3 46 910 5.0E-67
sp|B8NW36|MANBB_ASPFN Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mndB PE=3 SV=1 46 910 6.0E-67
sp|Q5B7W2|MANBB_EMENI Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mndB PE=1 SV=2 40 908 2.0E-66
sp|A2QYN2|MANBB_ASPNC Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mndB PE=3 SV=1 51 914 8.0E-65
sp|I2C092|MANBB_THIHE Beta-mannosidase B OS=Thielavia heterothallica GN=man9 PE=1 SV=1 47 736 2.0E-64
sp|Q0CCA0|MANBB_ASPTN Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mndB PE=3 SV=2 45 736 2.0E-64
sp|A1CGA8|MANBB_ASPCL Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mndB PE=3 SV=1 53 768 2.0E-64
sp|A1D911|MANBB_NEOFI Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mndB PE=3 SV=1 51 736 3.0E-63
sp|Q93324|MANBA_CAEEL Probable beta-mannosidase OS=Caenorhabditis elegans GN=C33G3.4 PE=1 SV=1 23 902 2.0E-62
sp|Q4WAH4|MANBB_ASPFU Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mndB PE=3 SV=1 51 736 5.0E-62
sp|B0YBU9|MANBB_ASPFC Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mndB PE=3 SV=1 51 736 2.0E-61
sp|O74168|MANBA_ASPAC Beta-mannosidase A OS=Aspergillus aculeatus GN=mndA PE=1 SV=1 723 929 2.0E-20
sp|Q75W54|EBM_ARATH Mannosylglycoprotein endo-beta-mannosidase OS=Arabidopsis thaliana GN=EBM PE=1 SV=3 46 752 5.0E-18
sp|Q5H7P5|EBM_LILLO Mannosylglycoprotein endo-beta-mannosidase OS=Lilium longiflorum GN=EBM PE=1 SV=4 46 501 2.0E-15
sp|D4AUH1|EBDG_ARTBC Exo-beta-D-glucosaminidase ARB_07888 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07888 PE=1 SV=1 197 443 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7976
MKLRHVVFAAAAWALQSASALRLVDLGAMRWTLRNTRLNISVPGNVPSQVHLDLQKAQIIPDPYRDLNEFDLRWV
ALSDWTYVTEIQGLQPQQHDTKLSSFLIFDGLDTFANISLCGHGVASTNNQFRQWRFNVSSIMASCPDLAPELKV
EFASAPKMADWLAAQPGAETWPWLVQGLFEFPNRAFIRKEQSDFGWDWGPAFAPAGIWKDARLVQLDHGQLAVPN
SAMDIYRKGQLNNLPPDQSADWVLNCSIDAIGHVPPSALMRYAVTDTTSATVVAQGYFSNVTVGQDVVTGSVTLN
ASRFALWWPVGMGKQNLYNISVDVMAHGQVVASVTKRTGFRTIVLNLGPITSTQIAQGIAPGNNWHFEINGREFY
AKGSNFIPPDAFWPRVTPDGIRTLFTSVVAGNQNMLRIWSSGAYSPDFVYDLADEMGILLWSEFEFGDALYPVTP
EFIENCRLEAVYQVRRINHHPSLALWAGGNELENLELPLVKALAPHDYARYLAEYEKLFLHTLLPAVYGNSRSIT
YIPSSTTNGYLSINFSNPIPIVQRYQNLTSGHLYGNTDHYNYNYREAFDIDTYPVGRFANEFGFHSMPSLAGWQE
ALSPNQLRLDSPAVMLRNHHYPAGGLMTDNYANSSKGMQEMLLAVTNYYPAPNKSNLLANFSAWCLASQRFQADY
YKSQIQFYRAGSGRPERQLGSLYWQLNDIWQAPTWASVEYSGRWKAVHYVARDIFKPVIVAPVFNTSSNTLHLYA
VSDLWHTVTGSLSVAWLSWEGESLSLDAPALVNFTIGPVNSTLVQSINMTRLASLPSFDARRAVLVANLSASSPP
DCTHTHTNTFTPTPLASAHLLDPGLTLCYSASTRLFNVTATRASSAWTWLSVADRDSSVMVAFDDNGFFLRRGES
KLVGFTHLAAHHNLCPGWEHRVQVESIWNSTLAT*
Coding >OphauG2|7976
ATGAAGCTTCGTCATGTCGTGTTCGCCGCTGCTGCTTGGGCACTCCAGTCCGCTTCTGCCCTGCGCCTTGTTGAC
CTTGGGGCAATGCGCTGGACGCTGCGGAATACGCGGCTCAACATTTCCGTCCCGGGCAATGTGCCTTCTCAGGTC
CATCTTGATCTGCAAAAGGCTCAGATTATACCTGACCCATACCGAGACCTGAATGAATTTGACTTGCGCTGGGTT
GCCTTGTCTGACTGGACATATGTCACTGAAATTCAAGGCCTCCAGCCCCAACAACATGACACCAAGCTATCAAGC
TTCCTCATTTTCGACGGCCTAGACACCTTTGCCAATATATCCCTGTGCGGCCATGGCGTTGCCAGCACAAACAAC
CAGTTCCGCCAATGGCGCTTCAACGTCTCCTCCATCATGGCCTCTTGCCCCGACTTGGCACCAGAGCTCAAGGTC
GAGTTTGCCAGCGCCCCCAAAATGGCCGACTGGCTCGCCGCCCAGCCCGGGGCTGAGACGTGGCCGTGGCTCGTC
CAGGGCCTCTTTGAGTTTCCCAACCGTGCTTTTATCCGCAAAGAACAGTCCGACTTTGGCTGGGACTGGGGCCCT
GCTTTTGCTCCCGCCGGGATCTGGAAAGACGCTCGCCTTGTCCAGCTTGACCACGGCCAGCTTGCCGTGCCCAAT
TCTGCCATGGATATTTACCGCAAGGGGCAGCTGAATAACCTGCCGCCTGATCAGAGTGCCGACTGGGTGCTGAAC
TGCAGCATTGATGCCATTGGTCATGTCCCACCCTCAGCACTCATGAGATATGCCGTTACAGATACTACATCAGCC
ACGGTTGTGGCACAAGGCTACTTTAGCAATGTCACCGTCGGCCAAGACGTCGTTACCGGTTCCGTGACGCTCAAT
GCCTCCCGCTTTGCCCTGTGGTGGCCCGTCGGCATGGGCAAGCAGAACCTGTACAACATTTCCGTAGACGTCATG
GCCCATGGCCAAGTTGTTGCATCTGTAACCAAGAGGACCGGCTTCCGCACAATCGTCCTCAACCTCGGCCCCATT
ACCAGCACGCAAATCGCGCAGGGCATTGCCCCAGGCAACAATTGGCACTTTGAAATCAATGGACGTGAATTCTAC
GCCAAGGGCAGCAACTTTATCCCCCCCGATGCCTTTTGGCCTCGCGTCACGCCCGATGGAATCCGCACCCTGTTT
ACCTCGGTCGTGGCCGGCAACCAAAACATGCTGCGCATCTGGTCCAGCGGCGCCTACTCACCCGACTTTGTCTAC
GACTTGGCCGACGAAATGGGCATTTTGCTGTGGAGTGAATTTGAATTCGGCGACGCCTTGTACCCCGTCACCCCC
GAATTTATTGAAAATTGCCGCTTGGAGGCCGTCTACCAGGTCCGGCGCATCAACCATCATCCCTCGCTTGCGCTA
TGGGCTGGAGGCAACGAACTGGAAAACCTTGAACTCCCGCTCGTCAAGGCCCTCGCACCGCACGACTATGCCCGA
TACCTGGCAGAGTATGAGAAGCTGTTTCTGCACACCCTCTTGCCAGCTGTCTATGGCAACAGTCGGAGCATCACG
TATATTCCCAGCAGCACCACAAACGGCTATCTGTCCATCAACTTTTCCAACCCCATTCCCATTGTCCAGCGATAC
CAAAACTTGACCTCGGGCCACTTGTACGGCAACACGGATCACTACAACTACAACTATCGCGAGGCCTTTGACATT
GACACGTACCCCGTCGGCCGCTTCGCCAATGAATTCGGCTTCCACTCCATGCCCAGTCTAGCCGGCTGGCAAGAG
GCCCTTTCTCCCAATCAGCTACGCCTCGATAGCCCCGCCGTCATGCTTCGCAATCACCACTATCCCGCCGGAGGT
CTCATGACGGACAATTACGCAAACTCTTCCAAGGGCATGCAGGAAATGCTCCTCGCCGTGACAAACTACTATCCA
GCCCCAAACAAGTCGAATCTGCTGGCAAACTTTTCCGCCTGGTGTCTTGCATCGCAGCGCTTCCAGGCCGACTAC
TACAAGTCTCAAATCCAATTCTACCGCGCCGGCTCGGGCCGTCCAGAGCGCCAGCTCGGCTCCTTGTACTGGCAG
CTCAATGACATTTGGCAGGCCCCAACCTGGGCCAGCGTCGAGTACAGCGGCCGCTGGAAGGCGGTGCACTATGTC
GCCCGCGATATTTTCAAGCCCGTCATTGTCGCCCCCGTCTTCAACACCTCGTCCAATACGCTGCACCTGTACGCC
GTCAGCGATCTCTGGCACACTGTTACGGGATCCTTGTCTGTTGCCTGGCTGAGCTGGGAGGGAGAAAGCTTGTCT
CTCGACGCACCAGCCCTCGTAAACTTTACCATTGGCCCCGTAAACAGCACTCTGGTTCAATCCATAAACATGACG
CGCCTCGCTTCCCTGCCATCCTTTGACGCCCGCCGCGCCGTCCTCGTGGCAAATCTCTCCGCCTCCAGCCCTCCT
GATTGCACGCACACACATACAAACACATTTACCCCGACTCCGCTTGCTTCCGCCCACCTGCTAGATCCCGGCCTG
ACACTTTGCTATTCTGCATCCACTCGCCTCTTCAACGTTACTGCTACCCGTGCTTCCAGCGCCTGGACCTGGCTC
AGTGTCGCCGACAGAGACTCATCCGTAATGGTTGCCTTTGACGACAATGGCTTCTTCTTGAGAAGAGGCGAATCC
AAACTTGTTGGCTTTACACACCTAGCCGCCCACCACAATCTCTGTCCTGGATGGGAGCATAGGGTCCAGGTTGAA
AGTATTTGGAACAGCACCTTGGCCACCTAA
Transcript >OphauG2|7976
ATGAAGCTTCGTCATGTCGTGTTCGCCGCTGCTGCTTGGGCACTCCAGTCCGCTTCTGCCCTGCGCCTTGTTGAC
CTTGGGGCAATGCGCTGGACGCTGCGGAATACGCGGCTCAACATTTCCGTCCCGGGCAATGTGCCTTCTCAGGTC
CATCTTGATCTGCAAAAGGCTCAGATTATACCTGACCCATACCGAGACCTGAATGAATTTGACTTGCGCTGGGTT
GCCTTGTCTGACTGGACATATGTCACTGAAATTCAAGGCCTCCAGCCCCAACAACATGACACCAAGCTATCAAGC
TTCCTCATTTTCGACGGCCTAGACACCTTTGCCAATATATCCCTGTGCGGCCATGGCGTTGCCAGCACAAACAAC
CAGTTCCGCCAATGGCGCTTCAACGTCTCCTCCATCATGGCCTCTTGCCCCGACTTGGCACCAGAGCTCAAGGTC
GAGTTTGCCAGCGCCCCCAAAATGGCCGACTGGCTCGCCGCCCAGCCCGGGGCTGAGACGTGGCCGTGGCTCGTC
CAGGGCCTCTTTGAGTTTCCCAACCGTGCTTTTATCCGCAAAGAACAGTCCGACTTTGGCTGGGACTGGGGCCCT
GCTTTTGCTCCCGCCGGGATCTGGAAAGACGCTCGCCTTGTCCAGCTTGACCACGGCCAGCTTGCCGTGCCCAAT
TCTGCCATGGATATTTACCGCAAGGGGCAGCTGAATAACCTGCCGCCTGATCAGAGTGCCGACTGGGTGCTGAAC
TGCAGCATTGATGCCATTGGTCATGTCCCACCCTCAGCACTCATGAGATATGCCGTTACAGATACTACATCAGCC
ACGGTTGTGGCACAAGGCTACTTTAGCAATGTCACCGTCGGCCAAGACGTCGTTACCGGTTCCGTGACGCTCAAT
GCCTCCCGCTTTGCCCTGTGGTGGCCCGTCGGCATGGGCAAGCAGAACCTGTACAACATTTCCGTAGACGTCATG
GCCCATGGCCAAGTTGTTGCATCTGTAACCAAGAGGACCGGCTTCCGCACAATCGTCCTCAACCTCGGCCCCATT
ACCAGCACGCAAATCGCGCAGGGCATTGCCCCAGGCAACAATTGGCACTTTGAAATCAATGGACGTGAATTCTAC
GCCAAGGGCAGCAACTTTATCCCCCCCGATGCCTTTTGGCCTCGCGTCACGCCCGATGGAATCCGCACCCTGTTT
ACCTCGGTCGTGGCCGGCAACCAAAACATGCTGCGCATCTGGTCCAGCGGCGCCTACTCACCCGACTTTGTCTAC
GACTTGGCCGACGAAATGGGCATTTTGCTGTGGAGTGAATTTGAATTCGGCGACGCCTTGTACCCCGTCACCCCC
GAATTTATTGAAAATTGCCGCTTGGAGGCCGTCTACCAGGTCCGGCGCATCAACCATCATCCCTCGCTTGCGCTA
TGGGCTGGAGGCAACGAACTGGAAAACCTTGAACTCCCGCTCGTCAAGGCCCTCGCACCGCACGACTATGCCCGA
TACCTGGCAGAGTATGAGAAGCTGTTTCTGCACACCCTCTTGCCAGCTGTCTATGGCAACAGTCGGAGCATCACG
TATATTCCCAGCAGCACCACAAACGGCTATCTGTCCATCAACTTTTCCAACCCCATTCCCATTGTCCAGCGATAC
CAAAACTTGACCTCGGGCCACTTGTACGGCAACACGGATCACTACAACTACAACTATCGCGAGGCCTTTGACATT
GACACGTACCCCGTCGGCCGCTTCGCCAATGAATTCGGCTTCCACTCCATGCCCAGTCTAGCCGGCTGGCAAGAG
GCCCTTTCTCCCAATCAGCTACGCCTCGATAGCCCCGCCGTCATGCTTCGCAATCACCACTATCCCGCCGGAGGT
CTCATGACGGACAATTACGCAAACTCTTCCAAGGGCATGCAGGAAATGCTCCTCGCCGTGACAAACTACTATCCA
GCCCCAAACAAGTCGAATCTGCTGGCAAACTTTTCCGCCTGGTGTCTTGCATCGCAGCGCTTCCAGGCCGACTAC
TACAAGTCTCAAATCCAATTCTACCGCGCCGGCTCGGGCCGTCCAGAGCGCCAGCTCGGCTCCTTGTACTGGCAG
CTCAATGACATTTGGCAGGCCCCAACCTGGGCCAGCGTCGAGTACAGCGGCCGCTGGAAGGCGGTGCACTATGTC
GCCCGCGATATTTTCAAGCCCGTCATTGTCGCCCCCGTCTTCAACACCTCGTCCAATACGCTGCACCTGTACGCC
GTCAGCGATCTCTGGCACACTGTTACGGGATCCTTGTCTGTTGCCTGGCTGAGCTGGGAGGGAGAAAGCTTGTCT
CTCGACGCACCAGCCCTCGTAAACTTTACCATTGGCCCCGTAAACAGCACTCTGGTTCAATCCATAAACATGACG
CGCCTCGCTTCCCTGCCATCCTTTGACGCCCGCCGCGCCGTCCTCGTGGCAAATCTCTCCGCCTCCAGCCCTCCT
GATTGCACGCACACACATACAAACACATTTACCCCGACTCCGCTTGCTTCCGCCCACCTGCTAGATCCCGGCCTG
ACACTTTGCTATTCTGCATCCACTCGCCTCTTCAACGTTACTGCTACCCGTGCTTCCAGCGCCTGGACCTGGCTC
AGTGTCGCCGACAGAGACTCATCCGTAATGGTTGCCTTTGACGACAATGGCTTCTTCTTGAGAAGAGGCGAATCC
AAACTTGTTGGCTTTACACACCTAGCCGCCCACCACAATCTCTGTCCTGGATGGGAGCATAGGGTCCAGGTTGAA
AGTATTTGGAACAGCACCTTGGCCACCTAA
Gene >OphauG2|7976
ATGAAGCTTCGTCATGTCGTGTTCGCCGCTGCTGCTTGGGCACTCCAGTCCGCTTCTGCCCTGCGCCTTGTTGAC
CTTGGGGCAATGCGCTGGACGCTGCGGAATACGCGGCTCAACATTTCCGTCCCGGGCAATGTGCCTTCTCAGGTC
CATCTTGATCTGCAAAAGGCTCAGATTATACCTGACCCGTAAGCCGCCTCGTACTCAAAATCCATGGCAAATAAG
ATGCCCTCCTCCCCGTTCTTAAAGCCCTCGCTAGATACCGAGACCTGAATGAATTTGACTTGCGCTGGGTTGCCT
TGTCTGACTGGACATATGTCACTGAAATTCAAGGCCTGTGAGTCTTTTTTCCTCGTCCTTGTATGCATAATCAAA
GCCTTGTTTTGCATCTCACCTTCAAGTCAGCCAGCCCCAACAACATGACACCAAGCTATCAAGCTTCCTCATTTT
CGACGGCCTAGACACCTTTGCCAATATATCCCTGTGCGGCCATGGCGTTGCCAGCACAAACAACCAGTTCCGCCA
ATGGCGCTTCAACGTCTCCTCCATCATGGCCTCTTGCCCCGACTTGGCACCAGAGCTCAAGGTCGAGTTTGCCAG
CGCCCCCAAAATGGCCGACTGGCTCGCCGCCCAGCCCGGGGCTGAGACGTGGCCGTGGCTCGTCCAGGGCCTCTT
TGAGTTTCCCAACCGTGCTTTTATCCGCAAAGAACAGTCCGACTTTGGCTGGGACTGGGGCCCTGCTTTTGCTCC
CGCCGGGATCTGGAAAGACGCTCGCCTTGTCCAGCTTGACCACGGCCAGCTTGCCGTGCCCAATTCTGCCATGGA
TATTTACCGCAAGGGGCAGCTGAATAACCTGCCGCCTGATCAGAGTGCCGACTGGGTGCTGAACTGCAGCATTGA
TGCCATTGGTCATGTCCCACCCTCAGCACTCATGAGATATGCCGTTACAGATACTACATCAGCCACGGTTGTGGC
ACAAGGCTACTTTAGCAATGTCACCGTCGGCCAAGACGTCGTTACCGGTTCCGTGACGCTCAATGCCTCCCGCTT
TGCCCTGTGGTGGCCCGTCGGCATGGGCAAGCAGAACCTGTACAACATTTCCGTAGACGTCATGGCCCATGGCCA
AGTTGTTGCATCTGTAACCAAGAGGACCGGCTTCCGCACAATCGTCCTCAACCTCGGCCCCATTACCAGCACGCA
AATCGCGCAGGGCATTGCCCCAGGCAACAATTGTAAGTCTTTTTTTTGTTTCTTTTTTTTTATTTGTTTCTATTT
TTTTTCCATTTGTTTCTAATTTTTTTTCTAATTTTTTTCTATTTTTTTGTTTGTTTATTCCCCTCTTGTCCCACG
CAGCAGCACACCTCGCGAGCAAGTCCGTCCACGACTGACACAAATAATAATCAGGGCACTTTGAAATCAATGGAC
GTGAATTCTACGCCAAGGGCAGCAACTTTATCCCCCCCGATGCCTTTTGGCCTCGCGTCACGCCCGATGGAATCC
GCACCCTGTTTACCTCGGTCGTGGCCGGCAACCAAAACATGCTGCGCATCTGGTCCAGCGGCGCCTACTCACCCG
ACTTTGTCTACGACTTGGCCGACGAAATGGGCATTTTGCTGTGGAGTGAATTTGAATTCGGCGACGCCTTGTACC
CCGTCACCCCCGAATTTATTGAAAATTGCCGCTTGGAGGCCGTCTACCAGGTCCGGCGCATCAACCATCATCCCT
CGCTTGCGCTATGGGCTGGAGGCAACGAACTGGAAAACCTTGAACTCCCGCTCGTCAAGGCCCTCGCACCGCACG
ACTATGCCCGATACCTGGCAGAGTATGAGAAGCTGTTTCTGCACACCCTCTTGCCAGCTGTCTATGGCAACAGTC
GGAGCATCACGTATATTCCCAGCAGCACCACAAACGGCTATCTGTCCATCAACTTTTCCAACCCCATTCCCATTG
TCCAGCGATACCAAAACTTGACCTCGGGCCACTTGTACGGCAACACGGATCACTACAACTACAACTATCGCGAGG
CCTTTGACATTGACACGTACCCCGTCGGCCGCTTCGCCAATGAATTCGGCTTCCACTCCATGCCCAGTCTAGCCG
GCTGGCAAGAGGCCCTTTCTCCCAATCAGCTACGCCTCGATAGCCCCGCCGTCATGCTTCGCAATCACCACTATC
CCGCCGGAGGTCTCATGACGGACAATTACGCAAACTCTTCCAAGGGCATGCAGGAAATGCTCCTCGCCGTGACAA
ACTACTATCCAGCCCCAAACAAGTCGAATCTGCTGGCAAACTTTTCCGCCTGGTGTCTTGCATCGCAGCGCTTCC
AGGCCGACTACTACAAGTCTCAAATCCAATTCTACCGCGCCGGCTCGGGCCGTCCAGAGCGCCAGCTCGGCTCCT
TGTACTGGCAGCTCAATGACATTTGGCAGGCCCCAACCTGGGCCAGCGTCGAGTACAGCGGCCGCTGGAAGGCGG
TGCACTATGTCGCCCGCGATATTTTCAAGCCCGTCATTGTCGCCCCCGTCTTCAACACCTCGTCCAATACGCTGC
ACCTGTACGCCGTCAGCGATCTCTGGCACACTGTTACGGGATCCTTGTCTGTTGCCTGGCTGAGCTGGGAGGGAG
AAAGCTTGTCTCTCGACGCACCAGCCCTCGTAAACTTTACCATTGGCCCCGTAAACAGCACTCTGGTTCAATCCA
TAAACATGACGCGCCTCGCTTCCCTGCCATCCTTTGACGCCCGCCGCGCCGTCCTCGTGGCAAATCTCTCCGCCT
CCAGCCCTCCTGATTGCACGCACACACATACAAACACATTTACCCCGACTCCGCTTGCTTCCGCCCACCTGCTAG
ATCCCGGCCTGACACTTTGCTATTCTGCATCCACTCGCCTCTTCAACGTTACTGCTACCCGTGCTTCCAGCGCCT
GGACCTGGCTCAGTGTCGCCGACAGAGACTCATCCGTAATGGTTGCCTTTGACGACAATGGCTTCTTCTTGAGAA
GAGGCGAATCCAAACTTGTTGGCTTTACACACCTAGCCGCCCACCACAATCTCTGTCCTGGATGGGAGCATAGGG
TCCAGGTTGAAAGTATTTGGAACAGCACCTTGGCCACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail