Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7970
Gene name
LocationContig_99:24550..28891
Strand-
Gene length (bp)4341
Transcript length (bp)4161
Coding sequence length (bp)4161
Protein length (aa) 1387

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 2.9E-04 167 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0SBS8|NU159_CHATD Nucleoporin NUP159 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP159 PE=1 SV=1 904 1384 2.0E-84
sp|Q09847|NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup146 PE=1 SV=1 51 801 2.0E-40
sp|P35658|NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens GN=NUP214 PE=1 SV=2 36 424 3.0E-27
sp|Q80U93|NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus GN=Nup214 PE=1 SV=2 36 424 9.0E-25
sp|Q9W1X4|NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster GN=Nup214 PE=1 SV=2 52 421 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0SBS8|NU159_CHATD Nucleoporin NUP159 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP159 PE=1 SV=1 904 1384 2.0E-84
sp|Q09847|NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup146 PE=1 SV=1 51 801 2.0E-40
sp|P35658|NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens GN=NUP214 PE=1 SV=2 36 424 3.0E-27
sp|Q80U93|NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus GN=Nup214 PE=1 SV=2 36 424 9.0E-25
sp|Q9W1X4|NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster GN=Nup214 PE=1 SV=2 52 421 1.0E-17
sp|P40477|NU159_YEAST Nucleoporin NUP159 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP159 PE=1 SV=1 359 610 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7970
MAFGASSAQAPAAQGADLETIETEALSFLSIAGDAKVRLTAAWPSPPTPTSSLLSIASRKGLVAAAGPDQLTVAT
TESVRKALESPKDGETEIRSFDPQLTVPMPMRVSQLAFTADESHLVLSAESGGGLAVYEVQSLLAASTRPAYELS
TNGEALRHMVPNPTAEKAELCAFVTDGGNLHMANLKERLISPVLKSQVSCVCWSPKGKQLCAGLADGTIHQMTPE
GETKAEIARPPALGQSHVSSLSWLENNLFLVIHTTTHQTPPSCAYHMIQRDGSNSSLLFRKMSDPVPSYTSDKMP
HHSVLRLRDFPPNIQDVLIVSCTTSTEIGLLTRSSVPLDSTKPADSITNLFTTTELLDDTTRPTLPMTESMDDST
PIGIALDLSAKEKVYKPLPADEELAESPGPLPGLWVLAHEGVLCTWWLVYAESIKAGTSYPGLAAVGNANAVATS
VPAAPAASNSSFGAAAFGSSAFTAPAFGTSSQPGQTQSPFGTVASTPMASQSTTALGATTAASSPFASAQPSTPS
FGNLGGMAFGRASQLGMRNSAWSTSGPVFGMSGFSNFAKGSMNHNQGSLATASPPSASSGFASFANQGGFASVCS
TDASKPSAFAATNKSSDSAFSKMGVPSTDMDTSFPPLKDNQSSSSVFGSTPFKLESSFKPDPSQMEHDEKPRVSP
SGPSMFSNDFGSALKDVGNTPRATTPPTIQDKDMDLGEVAEQTPRAPNHAAPFSPTPQEESTTPKYTPAVTRFSL
PSSPLARLSQTGAESSVGNPSTKGALPLSLTSANVNQEDSTPQSSIRNKSAQSGQLSTAPTPTLFGSAPLPPDFV
KLPGDQDAFDGASTPNKPTAKGVPLPPDLDDTKATNKAEEAPLPPDFLTSRTTAKTYMDVPQLPQNSNADDQLES
DDASEDSVVDVAKDLDWDAAALKPSSALGLPSTSSSLGMANNGKVEAQKPKSKPLFGALGRKGPVFSPTNVASPR
SPSPLRTATLATPMVHDLTRSSKLSEFRASKQSPGQSLTSNFLDQQKKKKLAEEAEESRALVDEEDEEIQKILQS
DVQGTLEVNEFIAYSNVIEPARESIPAQVEAIYRDINSMIDTLGLNARSIKAFVKGHMEKRKQESMTRGDVESPD
DWVLCEASDLKQLLGHELTDDLEDGRTQNVGDKLDACRELCRDMQRLRAKQEDLRRTIMIRLDSKQAEAARGLPL
STEQMAQQNELRQGLATLTSLLTQAEDALVLVKTKLASTYSSGQGNSRPAPTVDAIVRTILKMTSEAEKRSGDID
VLETQMHKLQLGCSRRDALTLTTPQGKKKSMISSPDSTPSRGLRQSLVGGMASLGLSDGATPPRKKLSGFDREEK
RDLMEKRAKRRVMLDKLKESVQKKSVAVWSMDDDIA*
Coding >OphauG2|7970
ATGGCATTCGGGGCTTCGAGCGCGCAGGCTCCTGCTGCCCAGGGCGCTGACCTCGAGACCATTGAAACAGAGGCC
TTGAGCTTTCTCTCCATCGCCGGCGATGCCAAGGTGCGTCTCACAGCCGCCTGGCCGAGCCCCCCAACACCGACG
TCGTCGCTGCTCAGCATTGCCTCTCGAAAGGGCCTCGTGGCCGCCGCCGGCCCCGATCAACTCACAGTCGCAACC
ACTGAGTCGGTCCGCAAGGCCTTGGAGTCTCCCAAGGATGGCGAGACGGAGATACGCTCGTTTGACCCTCAGCTC
ACGGTGCCCATGCCCATGCGAGTCTCTCAGCTTGCCTTTACGGCTGACGAGAGTCACTTGGTCTTGTCGGCAGAG
TCAGGCGGCGGCCTCGCCGTATACGAGGTGCAAAGCTTGCTCGCCGCATCTACCCGGCCCGCCTATGAGCTGTCA
ACAAATGGCGAAGCTCTGCGGCACATGGTGCCCAATCCAACTGCGGAAAAGGCCGAACTATGCGCTTTTGTCACG
GATGGAGGCAACCTTCACATGGCCAATCTCAAGGAACGCCTCATCAGCCCCGTCTTGAAGAGCCAGGTCAGCTGC
GTATGCTGGAGCCCCAAGGGCAAGCAACTTTGTGCTGGTCTGGCCGACGGCACCATACATCAGATGACGCCCGAA
GGCGAGACCAAGGCAGAGATTGCCAGGCCTCCCGCTCTTGGCCAAAGCCACGTATCTTCCCTTTCGTGGCTGGAG
AATAACCTCTTTCTCGTCATCCATACCACCACGCACCAAACGCCGCCATCTTGCGCCTACCATATGATTCAACGA
GATGGCTCCAACTCATCTCTACTCTTTCGCAAAATGAGCGACCCTGTGCCATCCTATACTTCAGACAAGATGCCT
CATCATTCCGTCTTACGCCTCAGAGACTTTCCGCCAAACATACAAGACGTGCTCATTGTCTCATGCACGACATCA
ACTGAAATTGGATTGTTGACTCGATCTAGTGTTCCGCTAGACAGTACCAAGCCTGCAGATTCCATCACAAATCTC
TTCACCACCACGGAGCTGCTCGACGACACAACAAGACCAACTCTTCCAATGACGGAATCCATGGATGACTCTACA
CCTATTGGAATAGCTCTGGATCTCTCAGCAAAGGAAAAGGTGTACAAGCCCCTTCCTGCCGACGAGGAACTTGCC
GAGTCCCCGGGACCACTGCCTGGCTTGTGGGTTCTGGCACACGAAGGCGTGCTGTGCACCTGGTGGCTTGTATAC
GCGGAATCGATAAAGGCGGGCACCTCGTATCCTGGATTGGCTGCCGTCGGCAATGCCAATGCAGTAGCCACGTCT
GTGCCGGCAGCACCAGCTGCGTCCAATTCATCTTTTGGAGCTGCAGCCTTTGGCTCTTCAGCCTTCACAGCACCT
GCCTTTGGCACTTCATCACAGCCAGGTCAAACGCAGTCTCCCTTTGGAACAGTTGCTTCCACGCCCATGGCAAGC
CAGTCCACCACTGCCCTCGGAGCAACGACAGCTGCGTCGAGCCCCTTTGCATCTGCCCAGCCTTCCACACCAAGT
TTTGGAAATCTCGGCGGCATGGCGTTTGGGCGTGCTTCACAACTCGGCATGAGAAACTCGGCTTGGTCTACTTCT
GGCCCAGTTTTTGGCATGTCTGGCTTCTCCAACTTTGCCAAAGGCAGCATGAACCATAACCAGGGCTCCTTGGCC
ACAGCATCCCCCCCATCAGCATCGTCGGGCTTCGCCAGTTTTGCCAACCAAGGCGGATTTGCTTCAGTTTGTTCA
ACCGATGCTTCCAAGCCCAGCGCTTTTGCCGCCACAAATAAATCCTCAGACAGTGCTTTTTCCAAAATGGGCGTA
CCAAGTACCGATATGGACACATCATTCCCTCCTCTTAAGGATAATCAATCTTCTAGCTCCGTCTTTGGCTCCACC
CCCTTCAAACTAGAATCGTCCTTCAAGCCAGATCCCTCTCAAATGGAACACGACGAGAAGCCTCGAGTGAGCCCT
TCCGGGCCATCAATGTTCAGTAATGACTTTGGATCTGCTCTGAAAGATGTCGGAAATACACCGCGCGCCACAACG
CCTCCCACTATCCAGGATAAGGACATGGATTTGGGAGAGGTCGCTGAACAAACGCCACGAGCCCCCAACCATGCC
GCTCCTTTTTCTCCAACTCCGCAGGAAGAGTCGACCACTCCGAAATACACTCCAGCTGTAACGCGGTTCAGTCTC
CCCTCATCGCCTCTTGCCAGACTTTCACAGACTGGCGCCGAGTCCTCTGTGGGCAATCCGTCTACCAAAGGTGCA
CTGCCACTAAGTTTGACGTCAGCGAATGTCAATCAAGAGGACTCGACTCCGCAATCCAGCATACGGAACAAGTCG
GCTCAGTCAGGGCAGTTGTCGACTGCGCCTACCCCCACTCTATTTGGCTCGGCTCCATTGCCTCCAGATTTTGTC
AAGTTGCCGGGGGACCAAGATGCATTTGATGGCGCATCTACTCCCAACAAGCCAACCGCCAAGGGAGTTCCATTA
CCACCTGATTTGGATGACACAAAAGCGACAAATAAGGCGGAAGAGGCCCCCTTACCACCAGATTTCCTGACCTCA
AGGACGACGGCCAAGACATATATGGACGTTCCACAATTACCTCAAAACTCCAACGCAGACGATCAACTTGAGAGC
GATGACGCATCAGAGGACAGTGTTGTAGATGTTGCCAAGGACTTGGACTGGGATGCTGCGGCCCTGAAACCCTCG
TCTGCCTTGGGTCTACCAAGTACCTCTAGCAGTCTGGGAATGGCTAATAATGGCAAAGTGGAGGCACAGAAGCCC
AAGTCCAAGCCTTTGTTTGGAGCTCTTGGTCGAAAGGGCCCAGTGTTTTCGCCAACAAATGTGGCGAGTCCCCGG
TCTCCAAGTCCATTGCGCACAGCCACGTTGGCCACGCCCATGGTGCATGATTTGACGAGATCATCGAAGCTTTCA
GAATTCAGAGCAAGCAAGCAATCTCCAGGACAATCCTTAACGAGCAACTTCCTGGATCAGCAGAAGAAGAAGAAG
TTGGCTGAGGAGGCCGAAGAGTCTAGGGCGCTTGTTGACGAAGAGGATGAAGAGATTCAAAAGATATTGCAATCC
GATGTCCAAGGCACCCTGGAAGTGAATGAGTTTATAGCTTATTCCAACGTGATTGAACCAGCGAGGGAAAGCATT
CCCGCCCAAGTTGAAGCGATTTATCGCGATATCAACTCGATGATTGATACCTTGGGTCTCAATGCACGGTCTATC
AAGGCATTTGTGAAGGGACACATGGAGAAGCGCAAACAAGAATCCATGACAAGGGGTGACGTCGAGTCACCAGAT
GATTGGGTGCTTTGCGAAGCGTCAGACTTGAAACAGTTGTTGGGCCATGAGCTGACGGACGACCTCGAAGATGGA
AGAACGCAAAACGTTGGTGACAAGCTTGATGCTTGTCGCGAGCTTTGCCGAGATATGCAGAGGTTGAGAGCAAAA
CAGGAGGATCTCAGGAGAACAATCATGATACGACTGGATTCTAAACAAGCTGAAGCTGCGCGGGGTCTCCCTCTC
AGTACGGAGCAAATGGCACAGCAGAACGAGCTCAGACAGGGACTGGCGACTTTGACGAGCTTGCTAACGCAAGCC
GAAGACGCGCTGGTATTGGTCAAGACAAAGCTTGCCTCAACGTATAGCTCGGGCCAGGGAAACTCACGGCCGGCG
CCAACGGTGGATGCAATTGTACGAACGATATTGAAGATGACGTCCGAGGCGGAGAAGCGAAGCGGAGACATTGAC
GTTTTGGAGACACAAATGCACAAGCTACAGCTGGGGTGCAGCCGGCGTGACGCGTTGACTCTAACGACGCCTCAG
GGCAAGAAGAAGTCGATGATTTCATCGCCCGACTCGACACCATCACGCGGCCTGCGCCAAAGTCTGGTTGGGGGC
ATGGCTTCTCTTGGGCTTTCAGACGGCGCGACGCCGCCGAGGAAGAAGCTGAGCGGATTCGACAGGGAGGAGAAG
CGAGATCTAATGGAAAAGAGAGCTAAGCGACGGGTCATGCTGGATAAGCTGAAGGAGAGCGTGCAAAAGAAGAGT
GTGGCTGTATGGAGCATGGACGACGACATTGCGTAG
Transcript >OphauG2|7970
ATGGCATTCGGGGCTTCGAGCGCGCAGGCTCCTGCTGCCCAGGGCGCTGACCTCGAGACCATTGAAACAGAGGCC
TTGAGCTTTCTCTCCATCGCCGGCGATGCCAAGGTGCGTCTCACAGCCGCCTGGCCGAGCCCCCCAACACCGACG
TCGTCGCTGCTCAGCATTGCCTCTCGAAAGGGCCTCGTGGCCGCCGCCGGCCCCGATCAACTCACAGTCGCAACC
ACTGAGTCGGTCCGCAAGGCCTTGGAGTCTCCCAAGGATGGCGAGACGGAGATACGCTCGTTTGACCCTCAGCTC
ACGGTGCCCATGCCCATGCGAGTCTCTCAGCTTGCCTTTACGGCTGACGAGAGTCACTTGGTCTTGTCGGCAGAG
TCAGGCGGCGGCCTCGCCGTATACGAGGTGCAAAGCTTGCTCGCCGCATCTACCCGGCCCGCCTATGAGCTGTCA
ACAAATGGCGAAGCTCTGCGGCACATGGTGCCCAATCCAACTGCGGAAAAGGCCGAACTATGCGCTTTTGTCACG
GATGGAGGCAACCTTCACATGGCCAATCTCAAGGAACGCCTCATCAGCCCCGTCTTGAAGAGCCAGGTCAGCTGC
GTATGCTGGAGCCCCAAGGGCAAGCAACTTTGTGCTGGTCTGGCCGACGGCACCATACATCAGATGACGCCCGAA
GGCGAGACCAAGGCAGAGATTGCCAGGCCTCCCGCTCTTGGCCAAAGCCACGTATCTTCCCTTTCGTGGCTGGAG
AATAACCTCTTTCTCGTCATCCATACCACCACGCACCAAACGCCGCCATCTTGCGCCTACCATATGATTCAACGA
GATGGCTCCAACTCATCTCTACTCTTTCGCAAAATGAGCGACCCTGTGCCATCCTATACTTCAGACAAGATGCCT
CATCATTCCGTCTTACGCCTCAGAGACTTTCCGCCAAACATACAAGACGTGCTCATTGTCTCATGCACGACATCA
ACTGAAATTGGATTGTTGACTCGATCTAGTGTTCCGCTAGACAGTACCAAGCCTGCAGATTCCATCACAAATCTC
TTCACCACCACGGAGCTGCTCGACGACACAACAAGACCAACTCTTCCAATGACGGAATCCATGGATGACTCTACA
CCTATTGGAATAGCTCTGGATCTCTCAGCAAAGGAAAAGGTGTACAAGCCCCTTCCTGCCGACGAGGAACTTGCC
GAGTCCCCGGGACCACTGCCTGGCTTGTGGGTTCTGGCACACGAAGGCGTGCTGTGCACCTGGTGGCTTGTATAC
GCGGAATCGATAAAGGCGGGCACCTCGTATCCTGGATTGGCTGCCGTCGGCAATGCCAATGCAGTAGCCACGTCT
GTGCCGGCAGCACCAGCTGCGTCCAATTCATCTTTTGGAGCTGCAGCCTTTGGCTCTTCAGCCTTCACAGCACCT
GCCTTTGGCACTTCATCACAGCCAGGTCAAACGCAGTCTCCCTTTGGAACAGTTGCTTCCACGCCCATGGCAAGC
CAGTCCACCACTGCCCTCGGAGCAACGACAGCTGCGTCGAGCCCCTTTGCATCTGCCCAGCCTTCCACACCAAGT
TTTGGAAATCTCGGCGGCATGGCGTTTGGGCGTGCTTCACAACTCGGCATGAGAAACTCGGCTTGGTCTACTTCT
GGCCCAGTTTTTGGCATGTCTGGCTTCTCCAACTTTGCCAAAGGCAGCATGAACCATAACCAGGGCTCCTTGGCC
ACAGCATCCCCCCCATCAGCATCGTCGGGCTTCGCCAGTTTTGCCAACCAAGGCGGATTTGCTTCAGTTTGTTCA
ACCGATGCTTCCAAGCCCAGCGCTTTTGCCGCCACAAATAAATCCTCAGACAGTGCTTTTTCCAAAATGGGCGTA
CCAAGTACCGATATGGACACATCATTCCCTCCTCTTAAGGATAATCAATCTTCTAGCTCCGTCTTTGGCTCCACC
CCCTTCAAACTAGAATCGTCCTTCAAGCCAGATCCCTCTCAAATGGAACACGACGAGAAGCCTCGAGTGAGCCCT
TCCGGGCCATCAATGTTCAGTAATGACTTTGGATCTGCTCTGAAAGATGTCGGAAATACACCGCGCGCCACAACG
CCTCCCACTATCCAGGATAAGGACATGGATTTGGGAGAGGTCGCTGAACAAACGCCACGAGCCCCCAACCATGCC
GCTCCTTTTTCTCCAACTCCGCAGGAAGAGTCGACCACTCCGAAATACACTCCAGCTGTAACGCGGTTCAGTCTC
CCCTCATCGCCTCTTGCCAGACTTTCACAGACTGGCGCCGAGTCCTCTGTGGGCAATCCGTCTACCAAAGGTGCA
CTGCCACTAAGTTTGACGTCAGCGAATGTCAATCAAGAGGACTCGACTCCGCAATCCAGCATACGGAACAAGTCG
GCTCAGTCAGGGCAGTTGTCGACTGCGCCTACCCCCACTCTATTTGGCTCGGCTCCATTGCCTCCAGATTTTGTC
AAGTTGCCGGGGGACCAAGATGCATTTGATGGCGCATCTACTCCCAACAAGCCAACCGCCAAGGGAGTTCCATTA
CCACCTGATTTGGATGACACAAAAGCGACAAATAAGGCGGAAGAGGCCCCCTTACCACCAGATTTCCTGACCTCA
AGGACGACGGCCAAGACATATATGGACGTTCCACAATTACCTCAAAACTCCAACGCAGACGATCAACTTGAGAGC
GATGACGCATCAGAGGACAGTGTTGTAGATGTTGCCAAGGACTTGGACTGGGATGCTGCGGCCCTGAAACCCTCG
TCTGCCTTGGGTCTACCAAGTACCTCTAGCAGTCTGGGAATGGCTAATAATGGCAAAGTGGAGGCACAGAAGCCC
AAGTCCAAGCCTTTGTTTGGAGCTCTTGGTCGAAAGGGCCCAGTGTTTTCGCCAACAAATGTGGCGAGTCCCCGG
TCTCCAAGTCCATTGCGCACAGCCACGTTGGCCACGCCCATGGTGCATGATTTGACGAGATCATCGAAGCTTTCA
GAATTCAGAGCAAGCAAGCAATCTCCAGGACAATCCTTAACGAGCAACTTCCTGGATCAGCAGAAGAAGAAGAAG
TTGGCTGAGGAGGCCGAAGAGTCTAGGGCGCTTGTTGACGAAGAGGATGAAGAGATTCAAAAGATATTGCAATCC
GATGTCCAAGGCACCCTGGAAGTGAATGAGTTTATAGCTTATTCCAACGTGATTGAACCAGCGAGGGAAAGCATT
CCCGCCCAAGTTGAAGCGATTTATCGCGATATCAACTCGATGATTGATACCTTGGGTCTCAATGCACGGTCTATC
AAGGCATTTGTGAAGGGACACATGGAGAAGCGCAAACAAGAATCCATGACAAGGGGTGACGTCGAGTCACCAGAT
GATTGGGTGCTTTGCGAAGCGTCAGACTTGAAACAGTTGTTGGGCCATGAGCTGACGGACGACCTCGAAGATGGA
AGAACGCAAAACGTTGGTGACAAGCTTGATGCTTGTCGCGAGCTTTGCCGAGATATGCAGAGGTTGAGAGCAAAA
CAGGAGGATCTCAGGAGAACAATCATGATACGACTGGATTCTAAACAAGCTGAAGCTGCGCGGGGTCTCCCTCTC
AGTACGGAGCAAATGGCACAGCAGAACGAGCTCAGACAGGGACTGGCGACTTTGACGAGCTTGCTAACGCAAGCC
GAAGACGCGCTGGTATTGGTCAAGACAAAGCTTGCCTCAACGTATAGCTCGGGCCAGGGAAACTCACGGCCGGCG
CCAACGGTGGATGCAATTGTACGAACGATATTGAAGATGACGTCCGAGGCGGAGAAGCGAAGCGGAGACATTGAC
GTTTTGGAGACACAAATGCACAAGCTACAGCTGGGGTGCAGCCGGCGTGACGCGTTGACTCTAACGACGCCTCAG
GGCAAGAAGAAGTCGATGATTTCATCGCCCGACTCGACACCATCACGCGGCCTGCGCCAAAGTCTGGTTGGGGGC
ATGGCTTCTCTTGGGCTTTCAGACGGCGCGACGCCGCCGAGGAAGAAGCTGAGCGGATTCGACAGGGAGGAGAAG
CGAGATCTAATGGAAAAGAGAGCTAAGCGACGGGTCATGCTGGATAAGCTGAAGGAGAGCGTGCAAAAGAAGAGT
GTGGCTGTATGGAGCATGGACGACGACATTGCGTAG
Gene >OphauG2|7970
ATGGCATTCGGGGCTTCGAGCGCGCAGGCTCCTGCTGCCCAGGGCGCTGACCTCGAGACCATTGAAACAGAGGTG
AGCTTGACCAGTCAGACCGCCGCCCCATGACGACCAACACCCTTTTCCCACAGGCCTTGAGCTTTCTCTCCATCG
CCGGCGATGCCAAGGTGCGTCTCACAGCCGCCTGGCCGAGCCCCCCAACACCGACGTCGTCGCTGCTCAGCATTG
CCTCTCGAAAGGGCCTCGTGGCCGCCGCCGGCCCCGATCAACTCACAGTCGCAACCACTGAGTCGGTCCGCAAGG
CCTTGGAGTCTCCCAAGGATGGCGAGACGGAGATACGCTCGTTTGACCCTCAGCTCACGGTGCCCATGCCCATGC
GAGTCTCTCAGCTTGCCTTTACGGCTGACGAGAGTCACTTGGTCTTGTCGGCAGAGTCAGGCGGCGGCCTCGCCG
TATACGAGGTGCAAAGCTTGCTCGCCGCATCTACCCGGCCCGCCTATGAGCTGTCAACAAATGGCGAAGCTCTGC
GGCACATGGTGCCCAATCCAACTGCGGAAAAGGCCGAACTATGCGCTTTTGTCACGGATGGAGGCAACCTTCACA
TGGCCAATCTCAAGGAACGCCTCATCAGCCCCGTCTTGAAGAGCCAGGTCAGCTGCGTATGCTGGAGCCCCAAGG
GCAAGCAACTTTGTGCTGGTCTGGCCGACGGCACCATACATCAGATGACGCCCGAAGGCGAGACCAAGGCAGAGA
TTGCCAGGCCTCCCGCTCTTGGCCAAAGCCACGGTGAGTAAGCCTTGCTATCATGTGCTTGGTGCTCCTAGTCCC
TGCGCCAATCCTGACATGTGTTGCCTCCTAGTATCTTCCCTTTCGTGGCTGGAGAATAACCTCTTTCTCGTCATC
CATACCACCACGCACCAAACGCCGCCATCTTGCGCCTACCATATGATTCAACGAGATGGCTCCAACTCATCTCTA
CTCTTTCGCAAAATGAGCGACCCTGTGCCATCCTATACTTCAGACAAGATGCCTCATCATTCCGTCTTACGCCTC
AGAGACTTTCCGCCAAACATACAAGACGTGCTCATTGTCTCATGCACGACATCAACTGAAATTGGATTGTTGACT
CGATCTAGTGTTCCGCTAGACAGTACCAAGCCTGCAGATTCCATCACAAATCTCTTCACCACCACGGAGCTGCTC
GACGACACAACAAGACCAACTCTTCCAATGACGGAATCCATGGATGACTCTACACCTATTGGAATAGCTCTGGAT
CTCTCAGCAAAGGAAAAGGTGTACAAGCCCCTTCCTGCCGACGAGGAACTTGCCGAGTCCCCGGGACCACTGCCT
GGCTTGTGGGTTCTGGCACACGAAGGCGTGCTGTGCACCTGGTGGCTTGTATACGCGGAATCGATAAAGGCGGGC
ACCTCGTATCCTGGATTGGCTGCCGTCGGCAATGCCAATGCAGTAGCCACGTCTGTGCCGGCAGCACCAGCTGCG
TCCAATTCATCTTTTGGAGCTGCAGCCTTTGGCTCTTCAGCCTTCACAGCACCTGCCTTTGGCACTTCATCACAG
CCAGGTCAAACGCAGTCTCCCTTTGGAACAGTTGCTTCCACGCCCATGGCAAGCCAGTCCACCACTGCCCTCGGA
GCAACGACAGCTGCGTCGAGCCCCTTTGCATCTGCCCAGCCTTCCACACCAAGTTTTGGAAATCTCGGCGGCATG
GCGTTTGGGCGTGCTTCACAACTCGGCATGAGAAACTCGGCTTGGTCTACTTCTGGCCCAGTTTTTGGCATGTCT
GGCTTCTCCAACTTTGCCAAAGGCAGCATGAACCATAACCAGGGCTCCTTGGCCACAGCATCCCCCCCATCAGCA
TCGTCGGGCTTCGCCAGTTTTGCCAACCAAGGCGGATTTGCTTCAGTTTGTTCAACCGATGCTTCCAAGCCCAGC
GCTTTTGCCGCCACAAATAAATCCTCAGACAGTGCTTTTTCCAAAATGGGCGTACCAAGTACCGATATGGACACA
TCATTCCCTCCTCTTAAGGATAATCAATCTTCTAGCTCCGTCTTTGGCTCCACCCCCTTCAAACTAGAATCGTCC
TTCAAGCCAGATCCCTCTCAAATGGAACACGACGAGAAGCCTCGAGTGAGCCCTTCCGGGCCATCAATGTTCAGT
AATGACTTTGGATCTGCTCTGAAAGATGTCGGAAATACACCGCGCGCCACAACGCCTCCCACTATCCAGGATAAG
GACATGGATTTGGGAGAGGTCGCTGAACAAACGCCACGAGCCCCCAACCATGCCGCTCCTTTTTCTCCAACTCCG
CAGGAAGAGTCGACCACTCCGAAATACACTCCAGCTGTAACGCGGTTCAGTCTCCCCTCATCGCCTCTTGCCAGA
CTTTCACAGACTGGCGCCGAGTCCTCTGTGGGCAATCCGTCTACCAAAGGTGCACTGCCACTAAGTTTGACGTCA
GCGAATGTCAATCAAGAGGACTCGACTCCGCAATCCAGCATACGGAACAAGTCGGCTCAGTCAGGGCAGTTGTCG
ACTGCGCCTACCCCCACTCTATTTGGCTCGGCTCCATTGCCTCCAGATTTTGTCAAGTTGCCGGGGGACCAAGAT
GCATTTGATGGCGCATCTACTCCCAACAAGCCAACCGCCAAGGGAGTTCCATTACCACCTGATTTGGATGACACA
AAAGCGACAAATAAGGCGGAAGAGGCCCCCTTACCACCAGATTTCCTGACCTCAAGGACGACGGCCAAGACATAT
ATGGACGTTCCACAATTACCTCAAAACTCCAACGCAGACGATCAACTTGAGAGCGATGACGCATCAGAGGACAGT
GTTGTAGATGTTGCCAAGGACTTGGACTGGGATGCTGCGGCCCTGAAACCCTCGTCTGCCTTGGGTCTACCAAGT
ACCTCTAGCAGTCTGGGAATGGCTAATAATGGCAAAGTGGAGGCACAGAAGCCCAAGTCCAAGCCTTTGTTTGGA
GCTCTTGGTCGAAAGGGCCCAGTGTTTTCGCCAACAAATGTGGCGAGTCCCCGGTCTCCAAGTCCATTGCGCACA
GCCACGTTGGCCACGCCCATGGTGCATGATTTGACGAGATCAGTGAGTGCACCAGGAATGGCATCAGGTGTCTTG
AAAGCCAACATGTCACAGTCGAAGCTTTCAGAATTCAGAGCAAGCAAGCAATCTCCAGGACAATCCTTAACGAGC
AACTTCCTGGATCAGCAGAAGAAGAAGAAGTTGGCTGAGGAGGCCGAAGAGTCTAGGGCGCTTGTTGACGAAGAG
GATGAAGAGATTCAAAAGATATTGCAATCCGATGTCCAAGGCACCCTGGAAGTGAATGAGTTTATAGCTTATTCC
AACGTGATTGAACCAGCGAGGGAAAGCATTCCCGCCCAAGTTGAAGCGATTTATCGCGATATCAACTCGATGATT
GATACCTTGGGTCTCAATGCACGGTCTATCAAGGCATTTGTGAAGGGACACATGGAGAAGCGCAAACAAGAATCC
ATGACAAGGGGTGACGTCGAGTCACCAGATGATTGGGTGCTTTGCGAAGCGTCAGACTTGAAACAGTTGTTGGGC
CATGAGCTGACGGACGACCTCGAAGATGGAAGAACGCAAAACGTTGGTGACAAGCTTGATGCTTGTCGCGAGCTT
TGCCGAGATATGCAGAGGTTGAGAGCAAAACAGGAGGATCTCAGGAGAACAATCATGATACGACTGGATTCTAAA
CAAGCTGAAGCTGCGCGGGGTCTCCCTCTCAGTACGGAGCAAATGGCACAGCAGAACGAGCTCAGACAGGGACTG
GCGACTTTGACGAGCTTGCTAACGCAAGCCGAAGACGCGCTGGTATTGGTCAAGACAAAGCTTGCCTCAACGTAT
AGCTCGGGCCAGGGAAACTCACGGCCGGCGCCAACGGTGGATGCAATTGTACGAACGATATTGAAGATGACGTCC
GAGGCGGAGAAGCGAAGCGGAGACATTGACGTTTTGGAGACACAAATGCACAAGCTACAGCTGGGGTGCAGCCGG
CGTGACGCGTTGACTCTAACGACGCCTCAGGGCAAGAAGAAGTCGATGATTTCATCGCCCGACTCGACACCATCA
CGCGGCCTGCGCCAAAGTCTGGTTGGGGGCATGGCTTCTCTTGGGCTTTCAGACGGCGCGACGCCGCCGAGGAAG
AAGCTGAGCGGATTCGACAGGGAGGAGAAGCGAGATCTAATGGAAAAGAGAGCTAAGCGACGGGTCATGCTGGAT
AAGCTGAAGGAGAGCGTGCAAAAGAAGAGTGTGGCTGTATGGAGCATGGACGACGACATTGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail