Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7961
Gene name
LocationContig_99:2345..3208
Strand+
Gene length (bp)863
Transcript length (bp)429
Coding sequence length (bp)429
Protein length (aa) 143

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00125 Histone Core histone H2A/H2B/H3/H4 9.9E-18 16 102
PF16211 Histone_H2A_C C-terminus of histone H2A 1.4E-12 104 136
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 6.3E-05 36 100

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q873G4|H2AZ_NEUCR Histone H2A.Z OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hH2Az PE=3 SV=1 21 142 5.0E-82
sp|Q2GUP0|H2AZ_CHAGB Histone H2A.Z OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HTZ1 PE=3 SV=1 21 142 1.0E-81
sp|A4QVR2|H2AZ_MAGO7 Histone H2A.Z OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HTZ1 PE=3 SV=1 21 142 1.0E-81
sp|Q4IMD1|H2AZ_GIBZE Histone H2A.Z OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HTZ1 PE=3 SV=1 24 141 1.0E-77
sp|Q1DTG2|H2AZ_COCIM Histone H2A.Z OS=Coccidioides immitis (strain RS) GN=HTZ1 PE=3 SV=1 24 142 3.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q873G4|H2AZ_NEUCR Histone H2A.Z OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hH2Az PE=3 SV=1 21 142 5.0E-82
sp|Q2GUP0|H2AZ_CHAGB Histone H2A.Z OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HTZ1 PE=3 SV=1 21 142 1.0E-81
sp|A4QVR2|H2AZ_MAGO7 Histone H2A.Z OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HTZ1 PE=3 SV=1 21 142 1.0E-81
sp|Q4IMD1|H2AZ_GIBZE Histone H2A.Z OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HTZ1 PE=3 SV=1 24 141 1.0E-77
sp|Q1DTG2|H2AZ_COCIM Histone H2A.Z OS=Coccidioides immitis (strain RS) GN=HTZ1 PE=3 SV=1 24 142 3.0E-73
sp|A1C5F1|H2AZ_ASPCL Histone H2A.Z OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=HTZ1 PE=3 SV=1 24 139 4.0E-73
sp|A2R702|H2AZ_ASPNC Histone H2A.Z OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=HTZ1 PE=3 SV=1 24 138 5.0E-73
sp|A1D0C1|H2AZ_NEOFI Histone H2A.Z OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=htz1 PE=3 SV=1 24 139 5.0E-73
sp|Q4WE68|H2AZ_ASPFU Histone H2A.Z OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=htz1 PE=3 SV=1 24 139 5.0E-73
sp|Q2UJ80|H2AZ_ASPOR Histone H2A.Z OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=HTZ1 PE=3 SV=1 24 138 7.0E-73
sp|Q5AUJ1|H2AZ_EMENI Histone H2A.Z OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=htz1 PE=3 SV=1 24 139 1.0E-72
sp|Q09FM9|H2AZ_MONPU Histone H2A.Z OS=Monascus purpureus GN=HTZ1 PE=3 SV=1 24 136 4.0E-72
sp|Q0C919|H2AZ_ASPTN Histone H2A.Z OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=HTZ1 PE=3 SV=1 11 139 1.0E-70
sp|Q0UG93|H2AZ_PHANO Histone H2A.Z OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HTZ1 PE=3 SV=1 24 142 2.0E-66
sp|Q5AEE1|H2AZ_CANAL Histone H2A.Z OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTZ1 PE=3 SV=3 19 135 6.0E-66
sp|Q6C341|H2AZ_YARLI Histone H2A.Z OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HTZ1 PE=3 SV=1 26 136 2.0E-65
sp|Q6BQE9|H2AZ_DEBHA Histone H2A.Z OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HTZ1 PE=3 SV=3 19 136 3.0E-65
sp|Q6CUC8|H2AZ_KLULA Histone H2A.Z OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HTZ1 PE=3 SV=3 6 136 3.0E-65
sp|A5DXC6|H2AZ_LODEL Histone H2A.Z OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HTZ1 PE=3 SV=1 19 138 3.0E-65
sp|Q75CC6|H2AZ_ASHGO Histone H2A.Z OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HTZ1 PE=3 SV=3 6 134 4.0E-65
sp|A3GHC1|H2AZ_PICST Histone H2A.Z OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HTZ1 PE=3 SV=2 19 136 4.0E-65
sp|A5DQL2|H2AZ_PICGU Histone H2A.Z OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HTZ1 PE=3 SV=1 19 138 6.0E-65
sp|P48003|H2AZ_SCHPO Histone H2A.Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pht1 PE=1 SV=3 22 134 9.0E-61
sp|Q12692|H2AZ_YEAST Histone H2A.Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTZ1 PE=1 SV=3 6 134 3.0E-58
sp|Q4PHE4|H2AZ_USTMA Histone H2A.Z OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HTZ1 PE=3 SV=1 9 137 1.0E-56
sp|Q27511|H2AV_CAEEL Histone H2A.V OS=Caenorhabditis elegans GN=htz-1 PE=2 SV=3 1 130 4.0E-54
sp|P0CO00|H2AZ_CRYNJ Histone H2A.Z OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HTZ1 PE=3 SV=1 28 142 2.0E-52
sp|P0CO01|H2AZ_CRYNB Histone H2A.Z OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HTZ1 PE=3 SV=1 28 142 2.0E-52
sp|P08985|H2AV_DROME Histone H2A.v OS=Drosophila melanogaster GN=His2Av PE=1 SV=2 1 133 5.0E-51
sp|Q5BJ65|H2AV_XENTR Histone H2A.V OS=Xenopus tropicalis GN=h2afv PE=2 SV=3 1 137 7.0E-51
sp|Q6GM74|H2AV_XENLA Histone H2A.V OS=Xenopus laevis GN=h2afv PE=2 SV=3 1 137 7.0E-51
sp|Q6Y237|H2AV_PAGMA Histone H2A.V OS=Pagrus major GN=h2afv PE=2 SV=3 1 137 7.0E-51
sp|Q3THW5|H2AV_MOUSE Histone H2A.V OS=Mus musculus GN=H2afv PE=1 SV=3 1 137 7.0E-51
sp|Q71UI9|H2AV_HUMAN Histone H2A.V OS=Homo sapiens GN=H2AFV PE=1 SV=3 1 137 7.0E-51
sp|Q71PD7|H2AV_DANRE Histone H2A.V OS=Danio rerio GN=h2afv PE=2 SV=3 1 137 7.0E-51
sp|P02272|H2AV_CHICK Histone H2A.V OS=Gallus gallus GN=H2AFV PE=1 SV=2 1 137 7.0E-51
sp|Q32LA7|H2AV_BOVIN Histone H2A.V OS=Bos taurus GN=H2AFV PE=2 SV=3 1 137 7.0E-51
sp|Q6YNC8|H2AZ_SHEEP Histone H2A.Z OS=Ovis aries GN=H2AFZ PE=2 SV=3 1 135 1.0E-50
sp|P0C0S7|H2AZ_RAT Histone H2A.Z OS=Rattus norvegicus GN=H2afz PE=1 SV=2 1 135 1.0E-50
sp|Q5RC42|H2AZ_PONAB Histone H2A.Z OS=Pongo abelii GN=H2AFZ PE=2 SV=3 1 135 1.0E-50
sp|P22647|H2AZ_ONCMY Histone H2A.Z OS=Oncorhynchus mykiss GN=h2afz PE=1 SV=4 1 135 1.0E-50
sp|P0C0S6|H2AZ_MOUSE Histone H2A.Z OS=Mus musculus GN=H2afz PE=1 SV=2 1 135 1.0E-50
sp|P0C0S5|H2AZ_HUMAN Histone H2A.Z OS=Homo sapiens GN=H2AFZ PE=1 SV=2 1 135 1.0E-50
sp|P0C0S4|H2AZ_BOVIN Histone H2A.Z OS=Bos taurus GN=H2AFZ PE=1 SV=2 1 135 1.0E-50
sp|Q5ZMD6|H2AZ_CHICK Histone H2A.Z OS=Gallus gallus GN=H2AFZ PE=1 SV=3 1 135 1.0E-50
sp|O62695|H2AV_RABIT Histone H2A.V OS=Oryctolagus cuniculus GN=H2AFV PE=2 SV=3 1 137 3.0E-50
sp|P08991|H2AV_STRPU Histone H2A.V (Fragment) OS=Strongylocentrotus purpuratus GN=H2A.F/Z PE=1 SV=1 16 128 4.0E-50
sp|Q84MP7|H2AV3_ORYSJ Probable histone H2A variant 3 OS=Oryza sativa subsp. japonica GN=Os03g0743400 PE=2 SV=1 21 130 7.0E-50
sp|Q6DER6|H2AZL_XENTR Histone H2A.Z-like OS=Xenopus tropicalis GN=h2a.zl PE=2 SV=3 14 135 1.0E-48
sp|P70094|H2AZL_XENLA Histone H2A.Z-like OS=Xenopus laevis GN=h2a.zl1 PE=2 SV=3 14 135 1.0E-48
sp|Q9SII0|H2AV2_ARATH Probable histone H2A variant 2 OS=Arabidopsis thaliana GN=At2g38810 PE=2 SV=1 24 133 1.0E-48
sp|Q9C944|H2AV3_ARATH Probable histone H2A variant 3 OS=Arabidopsis thaliana GN=At1g52740 PE=1 SV=1 28 130 3.0E-47
sp|Q8H7Y8|H2AV1_ORYSJ Probable histone H2A variant 1 OS=Oryza sativa subsp. japonica GN=Os03g0162200 PE=2 SV=1 28 134 7.0E-47
sp|O23628|H2AV1_ARATH Histone H2A variant 1 OS=Arabidopsis thaliana GN=H2AV PE=1 SV=1 28 134 9.0E-47
sp|Q8S857|H2AV2_ORYSJ Probable histone H2A variant 2 OS=Oryza sativa subsp. japonica GN=Os10g0418000 PE=2 SV=1 28 134 3.0E-46
sp|P08992|H2AV_TETTS Histone H2A.Z OS=Tetrahymena thermophila (strain SB210) GN=HTA3 PE=1 SV=2 27 139 1.0E-42
sp|P02263|H2A4_CHICK Histone H2A-IV OS=Gallus gallus PE=1 SV=2 13 139 5.0E-39
sp|Q64523|H2A2C_MOUSE Histone H2A type 2-C OS=Mus musculus GN=Hist2h2ac PE=1 SV=3 13 139 6.0E-39
sp|Q16777|H2A2C_HUMAN Histone H2A type 2-C OS=Homo sapiens GN=HIST2H2AC PE=1 SV=4 13 139 6.0E-39
sp|A1A4R1|H2A2C_BOVIN Histone H2A type 2-C OS=Bos taurus GN=HIST2H2AC PE=2 SV=1 13 139 6.0E-39
sp|Q4FZT6|H2A3_RAT Histone H2A type 3 OS=Rattus norvegicus PE=2 SV=3 13 138 6.0E-39
sp|Q8BFU2|H2A3_MOUSE Histone H2A type 3 OS=Mus musculus GN=Hist3h2a PE=1 SV=3 13 138 6.0E-39
sp|Q7L7L0|H2A3_HUMAN Histone H2A type 3 OS=Homo sapiens GN=HIST3H2A PE=1 SV=3 13 138 6.0E-39
sp|Q4R3X5|H2AJ_MACFA Histone H2A.J OS=Macaca fascicularis GN=H2AFJ PE=2 SV=1 13 139 9.0E-39
sp|A9UMV8|H2AJ_RAT Histone H2A.J OS=Rattus norvegicus GN=H2afj PE=2 SV=1 13 139 1.0E-38
sp|Q8R1M2|H2AJ_MOUSE Histone H2A.J OS=Mus musculus GN=H2afj PE=1 SV=1 13 139 1.0E-38
sp|P13912|H2A_CAIMO Histone H2A OS=Cairina moschata PE=3 SV=2 13 139 1.0E-38
sp|P0C169|H2A1C_RAT Histone H2A type 1-C OS=Rattus norvegicus PE=1 SV=2 13 138 2.0E-38
sp|Q93077|H2A1C_HUMAN Histone H2A type 1-C OS=Homo sapiens GN=HIST1H2AC PE=1 SV=3 13 138 2.0E-38
sp|P22752|H2A1_MOUSE Histone H2A type 1 OS=Mus musculus GN=Hist1h2ab PE=1 SV=3 13 138 2.0E-38
sp|P04908|H2A1B_HUMAN Histone H2A type 1-B/E OS=Homo sapiens GN=HIST1H2AB PE=1 SV=2 13 138 2.0E-38
sp|Q8CGP6|H2A1H_MOUSE Histone H2A type 1-H OS=Mus musculus GN=Hist1h2ah PE=1 SV=3 13 138 2.0E-38
sp|P70082|H2AJ_CHICK Histone H2A.J OS=Gallus gallus GN=H2A-IX PE=3 SV=1 13 139 2.0E-38
sp|Q8CGP7|H2A1K_MOUSE Histone H2A type 1-K OS=Mus musculus GN=Hist1h2ak PE=1 SV=3 13 138 3.0E-38
sp|P35062|H2A3_CHICK Histone H2A-III OS=Gallus gallus PE=1 SV=2 13 139 3.0E-38
sp|P0C170|H2A1E_RAT Histone H2A type 1-E OS=Rattus norvegicus PE=1 SV=2 13 138 4.0E-38
sp|Q9BTM1|H2AJ_HUMAN Histone H2A.J OS=Homo sapiens GN=H2AFJ PE=1 SV=1 13 139 4.0E-38
sp|Q3ZBX9|H2AJ_BOVIN Histone H2A.J OS=Bos taurus GN=H2AFJ PE=2 SV=1 13 139 4.0E-38
sp|P40282|H2A_PLAFA Histone H2A OS=Plasmodium falciparum PE=2 SV=1 13 139 5.0E-38
sp|P0CC09|H2A2A_RAT Histone H2A type 2-A OS=Rattus norvegicus GN=Hist2h2aa3 PE=1 SV=1 13 138 6.0E-38
sp|Q6GSS7|H2A2A_MOUSE Histone H2A type 2-A OS=Mus musculus GN=Hist2h2aa1 PE=1 SV=3 13 138 6.0E-38
sp|Q6FI13|H2A2A_HUMAN Histone H2A type 2-A OS=Homo sapiens GN=HIST2H2AA3 PE=1 SV=3 13 138 6.0E-38
sp|Q8CGP5|H2A1F_MOUSE Histone H2A type 1-F OS=Mus musculus GN=Hist1h2af PE=1 SV=3 13 130 6.0E-38
sp|P02262|H2A1_RAT Histone H2A type 1 OS=Rattus norvegicus PE=1 SV=2 13 138 6.0E-38
sp|P20671|H2A1D_HUMAN Histone H2A type 1-D OS=Homo sapiens GN=HIST1H2AD PE=1 SV=2 13 138 7.0E-38
sp|P50567|H2A_CHLRE Histone H2A OS=Chlamydomonas reinhardtii GN=H2A-II PE=3 SV=1 1 130 1.0E-37
sp|P02274|H2A1_TETPY Histone H2A.1 OS=Tetrahymena pyriformis GN=HTA2 PE=1 SV=2 25 139 2.0E-37
sp|P02264|H2A_ONCMY Histone H2A OS=Oncorhynchus mykiss PE=1 SV=2 13 142 2.0E-37
sp|P0C0S8|H2A1_HUMAN Histone H2A type 1 OS=Homo sapiens GN=HIST1H2AG PE=1 SV=2 13 138 2.0E-37
sp|P0C0S9|H2A1_BOVIN Histone H2A type 1 OS=Bos taurus PE=1 SV=2 13 138 2.0E-37
sp|Q96KK5|H2A1H_HUMAN Histone H2A type 1-H OS=Homo sapiens GN=HIST1H2AH PE=1 SV=3 13 138 2.0E-37
sp|P27661|H2AX_MOUSE Histone H2AX OS=Mus musculus GN=H2afx PE=1 SV=2 13 130 2.0E-37
sp|P16104|H2AX_HUMAN Histone H2AX OS=Homo sapiens GN=H2AFX PE=1 SV=2 13 130 3.0E-37
sp|P04735|H2A1_PSAMI Late histone H2A.1 OS=Psammechinus miliaris PE=2 SV=2 1 139 3.0E-37
sp|Q6CK59|H2A_KLULA Histone H2A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HTA1 PE=3 SV=3 15 137 4.0E-37
sp|Q64598|H2A1F_RAT Histone H2A type 1-F OS=Rattus norvegicus PE=3 SV=3 13 130 4.0E-37
sp|A5DXS8|H2A2_LODEL Histone H2A.2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HTA2 PE=3 SV=1 1 130 4.0E-37
sp|P35065|H2A1_TETTS Histone H2A.1 OS=Tetrahymena thermophila (strain SB210) GN=HTA2 PE=1 SV=2 25 128 4.0E-37
sp|P35064|H2AX_TETTS Histone H2AX OS=Tetrahymena thermophila (strain SB210) GN=HTA1 PE=1 SV=2 25 138 5.0E-37
sp|Q99878|H2A1J_HUMAN Histone H2A type 1-J OS=Homo sapiens GN=HIST1H2AJ PE=1 SV=3 13 130 6.0E-37
sp|P02269|H2A_ASTRU Histone H2A OS=Asterias rubens PE=1 SV=2 11 139 6.0E-37
sp|P06897|H2A1_XENLA Histone H2A type 1 OS=Xenopus laevis PE=1 SV=2 9 139 7.0E-37
sp|P16865|H2A3_VOLCA Histone H2A-III OS=Volvox carteri PE=3 SV=1 1 130 7.0E-37
sp|P02273|H2AX_TETPY Histone H2AX OS=Tetrahymena pyriformis GN=HTA1 PE=1 SV=2 25 138 8.0E-37
sp|P04910|H2A2_SCHPO Histone H2A-beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hta2 PE=1 SV=2 9 136 9.0E-37
sp|Q7ZUY3|H2AX_DANRE Histone H2AX OS=Danio rerio GN=h2afx PE=2 SV=3 13 130 1.0E-36
sp|Q00728|H2A4_RAT Histone H2A type 4 OS=Rattus norvegicus PE=2 SV=2 9 130 1.0E-36
sp|P16886|H2AL_STRPU Late histone H2A.L3 OS=Strongylocentrotus purpuratus PE=1 SV=2 13 134 1.0E-36
sp|Q9LHQ5|H2A2_ARATH Probable histone H2A.2 OS=Arabidopsis thaliana GN=At3g20670 PE=1 SV=1 16 141 1.0E-36
sp|P35061|H2A_ACRFO Histone H2A OS=Acropora formosa PE=3 SV=2 1 136 1.0E-36
sp|Q64522|H2A2B_MOUSE Histone H2A type 2-B OS=Mus musculus GN=Hist2h2ab PE=1 SV=3 13 136 1.0E-36
sp|P04909|H2A1_SCHPO Histone H2A-alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hta1 PE=1 SV=3 9 132 1.0E-36
sp|Q74ZL4|H2A1_ASHGO Histone H2A.1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HTA1 PE=3 SV=3 15 142 1.0E-36
sp|P13630|H2A_PARLI Histone H2A OS=Paracentrotus lividus PE=3 SV=2 25 130 2.0E-36
sp|Q8IUE6|H2A2B_HUMAN Histone H2A type 2-B OS=Homo sapiens GN=HIST2H2AB PE=1 SV=3 13 136 2.0E-36
sp|P16866|H2A4_VOLCA Histone H2A-IV OS=Volvox carteri PE=3 SV=1 1 130 2.0E-36
sp|Q757L4|H2A2_ASHGO Histone H2A.2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HTA2 PE=3 SV=3 15 142 2.0E-36
sp|Q6BKW8|H2A1_DEBHA Histone H2A.1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HTA1 PE=3 SV=3 1 137 2.0E-36
sp|A5DBG4|H2A1_PICGU Histone H2A.1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HTA1 PE=3 SV=1 9 128 2.0E-36
sp|Q96QV6|H2A1A_HUMAN Histone H2A type 1-A OS=Homo sapiens GN=HIST1H2AA PE=1 SV=3 13 139 2.0E-36
sp|Q9LD28|H2A6_ARATH Histone H2A.6 OS=Arabidopsis thaliana GN=RAT5 PE=1 SV=1 16 130 2.0E-36
sp|Q9S9K7|H2AXB_ARATH Probable histone H2AXb OS=Arabidopsis thaliana GN=At1g54690 PE=1 SV=1 9 128 3.0E-36
sp|O04848|H2AXA_ARATH Probable histone H2AXa OS=Arabidopsis thaliana GN=At1g08880 PE=1 SV=1 9 128 3.0E-36
sp|Q6BRG3|H2A2_DEBHA Histone H2A.2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HTA2 PE=3 SV=3 1 139 3.0E-36
sp|P69141|H2A_STRPU Histone H2A, embryonic OS=Strongylocentrotus purpuratus PE=1 SV=2 13 130 4.0E-36
sp|P69142|H2AE_PSAMI Histone H2A, embryonic OS=Psammechinus miliaris PE=3 SV=2 13 130 4.0E-36
sp|P35063|H2AX_PICAB Histone H2AX OS=Picea abies PE=2 SV=1 8 136 6.0E-36
sp|O65759|H2AX_CICAR Histone H2AX OS=Cicer arietinum GN=HIS2A PE=2 SV=1 8 130 6.0E-36
sp|A3LXE7|H2A2_PICST Histone H2A.2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HTA2 PE=3 SV=1 1 128 7.0E-36
sp|Q9LZ46|H2A4_ARATH Probable histone H2A.4 OS=Arabidopsis thaliana GN=At5g02560 PE=1 SV=1 24 134 7.0E-36
sp|A5DJJ2|H2A2_PICGU Histone H2A.2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HTA2 PE=3 SV=1 4 130 8.0E-36
sp|A3LZZ0|H2A1_PICST Histone H2A.1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HTA2 PE=3 SV=1 1 139 8.0E-36
sp|A5DWF1|H2A1_LODEL Histone H2A.1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HTA1 PE=3 SV=1 1 128 9.0E-36
sp|P21896|H2A_CHITH Histone H2A OS=Chironomus thummi thummi PE=3 SV=2 28 137 1.0E-35
sp|Q84NJ4|H2A3_ORYSJ Probable histone H2A.3 OS=Oryza sativa subsp. japonica GN=Os08g0427700 PE=3 SV=1 15 128 1.0E-35
sp|A2YVE5|H2A3_ORYSI Probable histone H2A.3 OS=Oryza sativa subsp. indica GN=OsI_028288 PE=3 SV=1 15 128 1.0E-35
sp|O81826|H2A3_ARATH Probable histone H2A.3 OS=Arabidopsis thaliana GN=At4g27230 PE=1 SV=1 15 130 1.0E-35
sp|Q59VP2|H2A2_CANAL Histone H2A.2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTA2 PE=3 SV=3 1 128 2.0E-35
sp|P69140|H2A_PARAN Histone H2A, gonadal OS=Parechinus angulosus PE=1 SV=2 28 138 2.0E-35
sp|P69139|H2A3_PSAMI Late histone H2A.3, gonadal OS=Psammechinus miliaris PE=1 SV=2 28 138 2.0E-35
sp|Q9FJE8|H2A7_ARATH Probable histone H2A.7 OS=Arabidopsis thaliana GN=At5g59870 PE=1 SV=1 12 138 2.0E-35
sp|Q9C681|H2A1_ARATH Probable histone H2A.1 OS=Arabidopsis thaliana GN=At1g51060 PE=1 SV=1 16 130 2.0E-35
sp|Q59SU5|H2A1_CANAL Histone H2A.1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HTA1 PE=3 SV=3 1 139 2.0E-35
sp|Q43312|H2A7_WHEAT Protein H2A.7 OS=Triticum aestivum GN=H2A-4 PE=2 SV=3 15 141 3.0E-35
sp|P0CN98|H2A_CRYNJ Histone H2A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HTA1 PE=3 SV=1 13 139 4.0E-35
sp|P0CN99|H2A_CRYNB Histone H2A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HTA1 PE=3 SV=1 13 139 4.0E-35
sp|Q6ZL42|H2A2_ORYSJ Probable histone H2A.2 OS=Oryza sativa subsp. japonica GN=Os07g0545400 PE=2 SV=1 15 128 4.0E-35
sp|A2YMC6|H2A2_ORYSI Probable histone H2A.2 OS=Oryza sativa subsp. indica GN=OsI_025469 PE=3 SV=1 15 128 4.0E-35
sp|Q94F49|H2A5_ARATH Probable histone H2A.5 OS=Arabidopsis thaliana GN=At5g27670 PE=1 SV=1 12 130 5.0E-35
sp|P04911|H2A1_YEAST Histone H2A.1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTA1 PE=1 SV=2 27 142 6.0E-35
sp|Q6GM86|H2AX_XENLA Histone H2AX OS=Xenopus laevis GN=h2afx PE=1 SV=3 16 130 6.0E-35
sp|Q9M531|H2A_EUPES Histone H2A OS=Euphorbia esula PE=2 SV=1 3 128 6.0E-35
sp|Q6ZL43|H2A1_ORYSJ Probable histone H2A.1 OS=Oryza sativa subsp. japonica GN=Os07g0545300 PE=2 SV=1 28 141 9.0E-35
sp|A2YMC5|H2A1_ORYSI Probable histone H2A.1 OS=Oryza sativa subsp. indica GN=OsI_26380 PE=3 SV=2 28 141 9.0E-35
sp|Q6FM31|H2A2_CANGA Histone H2A.2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HTA2 PE=3 SV=3 24 137 1.0E-34
sp|Q75L11|H2A6_ORYSJ Probable histone H2A.6 OS=Oryza sativa subsp. japonica GN=Os05g0113900 PE=2 SV=2 1 130 1.0E-34
sp|A2XZN0|H2A6_ORYSI Probable histone H2A.6 OS=Oryza sativa subsp. indica GN=OsI_017523 PE=3 SV=2 1 130 1.0E-34
sp|P25470|H2A1_PEA Histone H2A.1 OS=Pisum sativum PE=2 SV=1 28 137 1.0E-34
sp|Q43208|H2A4_WHEAT Histone H2A.4 OS=Triticum aestivum GN=TH254 PE=2 SV=3 28 141 1.0E-34
sp|P02268|H2A_SEPOF Histone H2A OS=Sepia officinalis PE=1 SV=2 28 134 1.0E-34
sp|P25469|H2A1_SOLLC Histone H2A.1 OS=Solanum lycopersicum PE=2 SV=1 12 139 1.0E-34
sp|P84057|H2A_TIGCA Histone H2A OS=Tigriopus californicus GN=His2A PE=3 SV=2 28 135 2.0E-34
sp|P84056|H2A_RHYAM Histone H2A OS=Rhynchosciara americana GN=His2A PE=3 SV=2 28 135 2.0E-34
sp|P84055|H2A_DROYA Histone H2A OS=Drosophila yakuba GN=His2A PE=2 SV=2 28 135 2.0E-34
sp|P84054|H2A_DROSI Histone H2A OS=Drosophila simulans GN=His2A PE=3 SV=2 28 135 2.0E-34
sp|P84051|H2A_DROME Histone H2A OS=Drosophila melanogaster GN=His2A PE=1 SV=2 28 135 2.0E-34
sp|P84053|H2A_DROHY Histone H2A OS=Drosophila hydei GN=His2A PE=3 SV=2 28 135 2.0E-34
sp|P84052|H2A_DROER Histone H2A OS=Drosophila erecta GN=His2A PE=3 SV=2 28 135 2.0E-34
sp|P02270|H2A_SIPNU Histone H2A OS=Sipunculus nudus PE=1 SV=2 30 136 2.0E-34
sp|Q07135|H2AO_CHITH Histone H2A, orphon OS=Chironomus thummi thummi PE=3 SV=2 28 137 2.0E-34
sp|P09589|H2A3_LYTPI Histone H2A, sperm (Fragment) OS=Lytechinus pictus PE=2 SV=1 27 130 2.0E-34
sp|P04912|H2A2_YEAST Histone H2A.2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HTA2 PE=1 SV=2 27 139 2.0E-34
sp|O74268|H2A_BOTFB Histone H2A OS=Botryotinia fuckeliana (strain B05.10) GN=hta1 PE=3 SV=4 24 130 3.0E-34
sp|Q4PEF9|H2A_USTMA Histone H2A OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HTA1 PE=3 SV=3 25 128 3.0E-34
sp|Q6PV61|H2A_LITVA Histone H2A OS=Litopenaeus vannamei PE=1 SV=3 30 135 3.0E-34
sp|Q0CBD2|H2A_ASPTN Histone H2A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hta1 PE=3 SV=1 27 136 4.0E-34
sp|Q8LLP5|H2AXA_ORYSJ Probable histone H2AXa OS=Oryza sativa subsp. japonica GN=Os03g0721900 PE=3 SV=1 25 128 4.0E-34
sp|A2XLI0|H2AXA_ORYSI Probable histone H2AXa OS=Oryza sativa subsp. indica GN=OsI_012923 PE=3 SV=1 25 128 4.0E-34
sp|Q6FWM7|H2A1_CANGA Histone H2A.1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HTA1 PE=3 SV=3 27 137 4.0E-34
sp|Q2QS71|H2A7_ORYSJ Probable histone H2A.7 OS=Oryza sativa subsp. japonica GN=Os12g0438000 PE=2 SV=1 28 137 4.0E-34
sp|A2ZK29|H2A7_ORYSI Probable histone H2A.7 OS=Oryza sativa subsp. indica GN=OsI_036922 PE=3 SV=1 28 137 4.0E-34
sp|L7HZV6|H2A_MAGOY Histone H2A OS=Magnaporthe oryzae (strain Y34) GN=HTA1 PE=2 SV=1 27 130 4.0E-34
sp|P0CT12|H2A_MAGO7 Histone H2A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HTA1 PE=3 SV=1 27 130 4.0E-34
sp|A1D8G8|H2A_NEOFI Histone H2A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hta1 PE=3 SV=1 27 130 6.0E-34
sp|Q2U5A8|H2A_ASPOR Histone H2A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hta1 PE=3 SV=3 27 130 6.0E-34
sp|Q4WWC6|H2A_ASPFU Histone H2A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hta1 PE=3 SV=3 27 130 6.0E-34
sp|A1CJ10|H2A_ASPCL Histone H2A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hta1 PE=3 SV=1 27 130 6.0E-34
sp|P0C952|H2A_ASPNG Histone H2A OS=Aspergillus niger GN=httA PE=2 SV=1 27 130 6.0E-34
sp|P0C953|H2A_ASPNC Histone H2A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=httA PE=3 SV=1 27 130 6.0E-34
sp|Q8X132|H2A_NEUCR Histone H2A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hh2a PE=3 SV=3 27 130 7.0E-34
sp|Q4HTT1|H2A_GIBZE Histone H2A OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HTA1 PE=3 SV=3 27 130 7.0E-34
sp|P08844|H2A_EMENI Histone H2A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=htaA PE=3 SV=2 27 130 7.0E-34
sp|Q875B8|H2A_PODAS Histone H2A OS=Podospora anserina GN=HTA1 PE=3 SV=3 27 130 7.0E-34
sp|P19178|H2A_PLADU Histone H2A OS=Platynereis dumerilii PE=3 SV=2 28 136 7.0E-34
sp|Q2HU68|H2A1_MEDTR Probable histone H2A.1 OS=Medicago truncatula GN=MtrDRAFT_AC149210g1v1 PE=3 SV=1 24 134 8.0E-34
sp|Q9HGX4|H2A_AGABI Histone H2A OS=Agaricus bisporus PE=2 SV=3 25 128 8.0E-34
sp|Q2HH37|H2A_CHAGB Histone H2A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HTA1 PE=3 SV=2 27 130 9.0E-34
sp|P40281|H2A2_PEA Histone H2A.2 OS=Pisum sativum PE=2 SV=1 28 130 1.0E-33
sp|Q6L500|H2A4_ORYSJ Probable histone H2A.4 OS=Oryza sativa subsp. japonica GN=Os05g0461400 PE=2 SV=1 28 130 1.0E-33
sp|A2Y5G8|H2A4_ORYSI Probable histone H2A.4 OS=Oryza sativa subsp. indica GN=OsI_019561 PE=3 SV=1 28 130 1.0E-33
sp|A2ZK26|H2A8_ORYSI Probable histone H2A.8 OS=Oryza sativa subsp. indica GN=OsI_036919 PE=3 SV=1 28 137 2.0E-33
sp|P09588|H2A_CAEEL Histone H2A OS=Caenorhabditis elegans GN=his-3 PE=1 SV=2 28 130 2.0E-33
sp|P27325|H2A_URECA Histone H2A OS=Urechis caupo PE=3 SV=2 30 135 2.0E-33
sp|P19177|H2A_PETCR Histone H2A OS=Petroselinum crispum PE=2 SV=1 24 138 2.0E-33
sp|P04736|H2A2_PSAMI Late histone H2A.2.1 OS=Psammechinus miliaris PE=2 SV=2 34 130 2.0E-33
sp|P02277|H2A3_WHEAT Histone H2A.2.2 OS=Triticum aestivum PE=1 SV=1 1 128 3.0E-33
sp|Q94E96|H2A5_ORYSJ Probable histone H2A.5 OS=Oryza sativa subsp. japonica GN=Os01g0502700 PE=2 SV=1 20 128 3.0E-33
sp|A2WQG7|H2A5_ORYSI Probable histone H2A.5 OS=Oryza sativa subsp. indica GN=OsI_002060 PE=3 SV=1 20 128 3.0E-33
sp|P02275|H2A1_WHEAT Histone H2A.1 OS=Triticum aestivum GN=H2A-9 PE=1 SV=2 24 130 8.0E-33
sp|P02276|H2A2_WHEAT Histone H2A.2.1 OS=Triticum aestivum PE=1 SV=1 22 128 8.0E-33
sp|Q43213|H2A5_WHEAT Protein H2A.5 OS=Triticum aestivum GN=H2A-2 PE=2 SV=3 24 130 8.0E-33
sp|Q1S053|H2A3_MEDTR Probable histone H2A.3 OS=Medicago truncatula PE=3 SV=1 28 130 1.0E-32
sp|P07793|H2A4_PSAMI Late histone H2A.2.2 OS=Psammechinus miliaris PE=3 SV=2 34 130 1.0E-32
sp|P40280|H2A_MAIZE Histone H2A OS=Zea mays PE=2 SV=1 22 130 1.0E-32
sp|Q2HU65|H2A2_MEDTR Probable histone H2A.2 OS=Medicago truncatula GN=MtrDRAFT_AC149210g4v1 PE=3 SV=1 28 130 2.0E-32
sp|Q9T0H7|H2A8_ARATH Histone H2A.8 OS=Arabidopsis thaliana GN=At4g13570 PE=1 SV=1 34 124 3.0E-32
sp|Q43214|H2A6_WHEAT Protein H2A.6 OS=Triticum aestivum GN=H2A-3 PE=2 SV=3 16 130 3.0E-32
sp|Q6WV88|H2A_MYTGA Histone H2A OS=Mytilus galloprovincialis PE=3 SV=3 34 134 4.0E-32
sp|Q8I0T3|H2A_MYTED Histone H2A OS=Mytilus edulis PE=3 SV=3 34 134 4.0E-32
sp|Q6WV69|H2A_MYTCH Histone H2A OS=Mytilus chilensis PE=3 SV=3 34 134 4.0E-32
sp|Q6WV66|H2A_MYTCA Histone H2A OS=Mytilus californianus PE=3 SV=3 34 134 4.0E-32
sp|Q6WV67|H2A_MYTTR Histone H2A OS=Mytilus trossulus PE=3 SV=3 34 134 1.0E-31
sp|Q1E5N1|H2A_COCIM Histone H2A OS=Coccidioides immitis (strain RS) GN=HTA1 PE=3 SV=1 32 130 2.0E-31
sp|Q0U1A1|H2A_PHANO Histone H2A OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HTA1 PE=3 SV=1 34 130 1.0E-30
sp|Q6C4I6|H2A_YARLI Histone H2A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HTA1 PE=3 SV=3 8 128 3.0E-30
sp|Q9QZQ8|H2AY_MOUSE Core histone macro-H2A.1 OS=Mus musculus GN=H2afy PE=1 SV=3 8 130 5.0E-30
sp|Q02874|H2AY_RAT Core histone macro-H2A.1 OS=Rattus norvegicus GN=H2afy PE=1 SV=4 8 130 5.0E-30
sp|O75367|H2AY_HUMAN Core histone macro-H2A.1 OS=Homo sapiens GN=H2AFY PE=1 SV=4 8 130 6.0E-30
sp|O93327|H2AY_CHICK Core histone macro-H2A.1 OS=Gallus gallus GN=H2AFY PE=1 SV=3 8 130 6.0E-30
sp|P09590|H2A3_STRPU Histone H2A-beta, sperm (Fragment) OS=Strongylocentrotus purpuratus PE=1 SV=1 25 109 9.0E-30
sp|Q8CCK0|H2AW_MOUSE Core histone macro-H2A.2 OS=Mus musculus GN=H2afy2 PE=1 SV=3 18 130 6.0E-29
sp|Q9P0M6|H2AW_HUMAN Core histone macro-H2A.2 OS=Homo sapiens GN=H2AFY2 PE=1 SV=3 18 130 7.0E-29
sp|P40279|H2A_EUGGR Histone H2A OS=Euglena gracilis PE=2 SV=1 29 130 9.0E-29
sp|Q54LA5|H2AZ_DICDI Histone H2A.z OS=Dictyostelium discoideum GN=H2AZ PE=3 SV=1 30 134 4.0E-25
sp|Q5Y2C3|H2AY_TETTS Histone H2A.Y OS=Tetrahymena thermophila (strain SB210) GN=HTAY PE=2 SV=2 9 126 9.0E-24
sp|P35066|H2A_TRYCR Histone H2A OS=Trypanosoma cruzi PE=3 SV=2 29 127 8.0E-23
sp|Q54WG6|H2AX_DICDI Histone H2AX OS=Dictyostelium discoideum GN=H2AX PE=1 SV=1 16 121 1.0E-22
sp|Q2QPG9|H2AXB_ORYSJ Probable histone H2AXb OS=Oryza sativa subsp. japonica GN=Os12g0530000 PE=2 SV=1 28 137 7.0E-22
sp|A2ZL69|H2AXB_ORYSI Probable histone H2AXb OS=Oryza sativa subsp. indica GN=OsI_037312 PE=3 SV=1 28 137 7.0E-22
sp|P06898|H2A2_XENLA Histone H2A type 2 OS=Xenopus laevis PE=3 SV=3 9 137 8.0E-22
sp|P27892|H2A2_LEIIN Histone H2A.2 OS=Leishmania infantum PE=2 SV=1 24 127 1.0E-18
sp|P27891|H2A1_LEIIN Histone H2A.1 OS=Leishmania infantum PE=2 SV=1 24 124 3.0E-18
sp|Q54HW2|H2AV1_DICDI Histone H2A.v1 OS=Dictyostelium discoideum GN=H2Av1 PE=3 SV=1 24 135 4.0E-18
sp|Q9LD75|H2A2_LILLO Histone H2A.2 OS=Lilium longiflorum GN=gH2A PE=1 SV=1 13 127 3.0E-17
sp|C0HJQ3|H2A_ACIGU Histone H2A (Fragments) OS=Acipenser gueldenstaedtii PE=1 SV=1 13 98 2.0E-16
sp|Q9CQ70|H2AB1_MOUSE Histone H2A-Bbd type 1 OS=Mus musculus GN=H2afb1 PE=2 SV=1 28 111 7.0E-15
sp|P82897|H2A_OLILU Histone H2A (Fragment) OS=Olisthodiscus luteus PE=1 SV=1 58 123 2.0E-14
sp|Q9XG56|H2A1_LILLO Histone H2A.1 OS=Lilium longiflorum GN=gcH2A PE=2 SV=1 13 107 4.0E-13
sp|P0C5Z0|H2AB2_HUMAN Histone H2A-Bbd type 2/3 OS=Homo sapiens GN=H2AFB2 PE=2 SV=1 28 113 3.0E-12
sp|P0C5Y9|H2AB1_HUMAN Histone H2A-Bbd type 1 OS=Homo sapiens GN=H2AFB1 PE=2 SV=1 28 113 3.0E-11
sp|Q54HV9|H2AV2_DICDI Histone H2A.v2 OS=Dictyostelium discoideum GN=H2Av2 PE=3 SV=1 26 133 1.0E-07
sp|Q54BC2|H2BV1_DICDI Histone H2B.v1 OS=Dictyostelium discoideum GN=H2Bv1 PE=3 SV=1 46 118 6.0E-07
sp|P59890|H2A_HIPHI Histone H2A (Fragment) OS=Hippoglossus hippoglossus PE=1 SV=2 16 64 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3386
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7961 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2924
Ophiocordyceps camponoti-floridani Ophcf2|03786
Ophiocordyceps camponoti-rufipedis Ophun1|7155
Ophiocordyceps kimflemingae Ophio5|5002
Ophiocordyceps subramaniannii Hirsu2|6330

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7961
MAGGKGKSSGGKSSGGKTGAEGPKKQQSHSARAGLQFPCGRVKRFLKQNTQNKMRVGAKAAVYVTAVLEYLTAEV
LELAGNAAKDLKVKRITPRHLQLAIRGDEELDTLIRATIAFGGVLPHINRALLLKVEQKKKAKAIEA*
Coding >OphauG2|7961
ATGGCCGGCGGCAAAGGCAAATCATCGGGGGGGAAGAGCTCGGGAGGCAAGACTGGTGCCGAGGGCCCCAAGAAA
CAGCAGAGCCACTCAGCGCGCGCTGGTTTGCAGTTTCCTTGCGGCCGTGTCAAGCGCTTCCTCAAACAAAACACG
CAGAATAAAATGCGCGTCGGCGCAAAGGCTGCAGTATACGTTACCGCCGTACTGGAGTACCTTACCGCTGAAGTT
CTCGAGCTGGCCGGTAACGCTGCCAAAGATCTCAAAGTAAAGCGCATCACCCCGCGCCACCTACAGCTTGCCATT
CGAGGAGACGAAGAACTCGATACGCTGATTCGTGCCACAATTGCTTTTGGAGGCGTGTTGCCGCACATCAATCGT
GCTTTGCTCCTTAAAGTAGAACAGAAAAAGAAGGCCAAGGCTATCGAAGCATAG
Transcript >OphauG2|7961
ATGGCCGGCGGCAAAGGCAAATCATCGGGGGGGAAGAGCTCGGGAGGCAAGACTGGTGCCGAGGGCCCCAAGAAA
CAGCAGAGCCACTCAGCGCGCGCTGGTTTGCAGTTTCCTTGCGGCCGTGTCAAGCGCTTCCTCAAACAAAACACG
CAGAATAAAATGCGCGTCGGCGCAAAGGCTGCAGTATACGTTACCGCCGTACTGGAGTACCTTACCGCTGAAGTT
CTCGAGCTGGCCGGTAACGCTGCCAAAGATCTCAAAGTAAAGCGCATCACCCCGCGCCACCTACAGCTTGCCATT
CGAGGAGACGAAGAACTCGATACGCTGATTCGTGCCACAATTGCTTTTGGAGGCGTGTTGCCGCACATCAATCGT
GCTTTGCTCCTTAAAGTAGAACAGAAAAAGAAGGCCAAGGCTATCGAAGCATAG
Gene >OphauG2|7961
ATGGCCGGCGGCAAAGGCAAATCATCGGGGGGGAAGAGCTCGGGAGGCAAGACTGGTGCCGAGGGCCCCAAGAAA
CAGCAGAGCCACTCAGCGCGCGCTGGTTTGCAGGTGAGATTGCCGCGCCTAGGCGCATTTGCTCCTTGATCTTGA
TTGCTGGCCAGAAGTCCACATCGAGGCCATTTTGACCGCCTTCGACTCCTCCAACCATTGAATTGCCGCTTGTCA
TACGCCCTTTGGCCATGCTTTCTTGCACGGCCCCTTGCACGAGGTCAATTCAACCGCCTTGGCCGCCGCTGACAC
CAAAATCACGGCCCCAACTGCATCATGCTCTCTCGGCCCTGCTCTTGTGCTCGCGGCCGCCGACAAGTCCGCAAG
CCGGCTGCTAGTGCCGTCGCATATTGCCCTGTCGACTTGGCCATGTGTTATTGTGTCGCCTGTTGCAAGCCACTT
TACTGACAGCGTCTCTGACAGTTTCCTTGCGGCCGTGTCAAGCGCTTCCTCAAACAAAACACGCAGAATAAAATG
CGCGTCGGCGCAAAGGCTGCAGTATACGTTACCGCCGTACTGGAGTACCTTACCGCTGAAGTTCTCGAGCTGGCC
GGTGTACGTTGGTCTCTTTATTGATTTTTTCTCGGACATTGGGGGCACATGGGCTGACGTGGGTCCGTTTGCAGA
ACGCTGCCAAAGATCTCAAAGTAAAGCGCATCACCCCGCGCCACCTACAGCTTGCCATTCGAGGAGACGAAGAAC
TCGATACGCTGATTCGTGCCACAATTGCTTTTGGAGGCGTGTTGCCGCACATCAATCGTGCTTTGCTCCTTAAAG
TAGAACAGAAAAAGAAGGCCAAGGCTATCGAAGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail