Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7951
Gene name
LocationContig_985:537..3574
Strand+
Gene length (bp)3037
Transcript length (bp)2229
Coding sequence length (bp)2229
Protein length (aa) 743

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04059 RRM_2 RNA recognition motif 2 1.1E-38 546 642

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08965|MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei2 PE=1 SV=1 528 703 2.0E-54
sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 512 676 1.0E-36
sp|Q75M35|OML3_ORYSJ Protein MEI2-like 3 OS=Oryza sativa subsp. japonica GN=ML3 PE=2 SV=2 513 680 2.0E-35
sp|Q8W4I9|AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana GN=ML1 PE=1 SV=1 534 680 3.0E-35
sp|Q9LYN7|AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana GN=ML4 PE=2 SV=1 534 680 7.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08965|MEI2_SCHPO Meiosis protein mei2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei2 PE=1 SV=1 528 703 2.0E-54
sp|Q6ZI17|OML2_ORYSJ Protein MEI2-like 2 OS=Oryza sativa subsp. japonica GN=ML2 PE=2 SV=1 512 676 1.0E-36
sp|Q75M35|OML3_ORYSJ Protein MEI2-like 3 OS=Oryza sativa subsp. japonica GN=ML3 PE=2 SV=2 513 680 2.0E-35
sp|Q8W4I9|AML1_ARATH Protein MEI2-like 1 OS=Arabidopsis thaliana GN=ML1 PE=1 SV=1 534 680 3.0E-35
sp|Q9LYN7|AML4_ARATH Protein MEI2-like 4 OS=Arabidopsis thaliana GN=ML4 PE=2 SV=1 534 680 7.0E-35
sp|Q64M78|OML4_ORYSJ Protein MEI2-like 4 OS=Oryza sativa subsp. japonica GN=ML4 PE=2 SV=1 443 676 7.0E-35
sp|Q8VWF5|AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana GN=ML5 PE=1 SV=1 533 664 1.0E-32
sp|Q6EQX3|OML5_ORYSJ Protein MEI2-like 5 OS=Oryza sativa subsp. japonica GN=ML5 PE=2 SV=1 533 658 3.0E-31
sp|Q9SVV9|AML3_ARATH Protein MEI2-like 3 OS=Arabidopsis thaliana GN=ML3 PE=2 SV=2 534 666 2.0E-29
sp|Q9SJG8|AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana GN=ML2 PE=2 SV=2 525 663 1.0E-25
sp|A2WY46|EAR1_ORYSI Protein terminal ear1 homolog OS=Oryza sativa subsp. indica GN=PLA2 PE=2 SV=1 544 658 3.0E-21
sp|Q0JGS5|EAR1_ORYSJ Protein terminal ear1 homolog OS=Oryza sativa subsp. japonica GN=PLA2 PE=2 SV=1 544 658 4.0E-21
sp|O65001|TE1_MAIZE Protein terminal ear1 OS=Zea mays GN=TE1 PE=2 SV=1 543 655 6.0E-21
sp|Q6ET49|OML7_ORYSJ Protein MEI2-like 7 OS=Oryza sativa subsp. japonica GN=OML7 PE=2 SV=1 547 658 8.0E-12
sp|Q652K6|OML6_ORYSJ Protein MEI2-like 6 OS=Oryza sativa subsp. japonica GN=ML6 PE=2 SV=1 547 658 5.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4981
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7951 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4669
Ophiocordyceps camponoti-floridani Ophcf2|04256
Ophiocordyceps camponoti-rufipedis Ophun1|4716
Ophiocordyceps kimflemingae Ophio5|8617
Ophiocordyceps subramaniannii Hirsu2|2180

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7951
MYFLPQYRYLGLPACLTLSKLILSSLCPGLLFFPHLVLTIDSCSPTSHSCVRAFFLLSGVEKQVVGLSSSSCYCC
VTAVMAQVRDRDNPSSPRSSCGAADSFKGTPETRLTAFSPEDGSTKSSKLLHGLARSASATPPVGRPLTSFCVSA
THIDKDPFVTPSHQPGTRLSPTASTFSPFSASLKVGRAFDAAPIAAALSSDLGLSRHLHVSSSAHLSVTEVNAWL
SELEARGDPPCGARFSDSLDGQVCLHFSDIRDARSTIASARHAVKDWKVEYLDPSQLAKYGSPCRDSKRCSSGQV
DVLAAVPQDTSLDVIQAMEAVQRLLQCNGRLFAFVRRSTFPNGSFKAMAEFCDANAAELAASSLGNIITSEGIHL
LVSPHLVELSDGSGVMEAFQSLSMGRGRSGVDQHQAALDTSASRLAGPMDMRIHPTFAMYPLMFQPQFAAAPTGM
SYLLDSFIPSGAQGPMTPMAPVSPSYSVAGPLYHTPPSPALTSQNSFSPSRSLTDFGRSDARRQHAMRINRSPYH
NVASHHNHVDILRIRDGIDVRTTIMLRNIPNKVDQAMLKRIIDESSWGKYDFMYLRIDFANDCNVGYAFINFVDP
LDIIDFVDARGNQRWNCFKSDKVAEISYATIQGKDCLVQKFRNSSVMLEAPHYRPKLYFTSNGPMPELAGQEEPF
PEPDNQSKMKRSCENAEHVGLFTPNAGQHFRDEQRRRRSQYDRGTRLAALEEYDYETAIQHLYGTPT*
Coding >OphauG2|7951
ATGTACTTCCTGCCTCAATACAGGTACCTGGGTCTTCCTGCCTGCCTCACCTTGTCGAAGCTGATCCTATCCAGC
CTGTGCCCTGGCCTCTTGTTTTTTCCTCACCTTGTCCTTACCATAGACTCTTGCTCACCTACCTCACACTCTTGT
GTACGGGCCTTCTTCCTGCTATCAGGGGTGGAAAAGCAGGTAGTAGGCTTGTCGTCTTCGTCTTGCTACTGCTGT
GTCACTGCTGTCATGGCCCAAGTTCGGGATCGCGATAATCCATCGTCGCCGAGATCCTCGTGCGGTGCCGCCGAC
TCTTTCAAGGGCACACCAGAGACACGTTTGACAGCCTTTTCTCCCGAAGATGGCTCGACCAAGTCATCTAAGCTT
CTACATGGACTTGCCCGCTCCGCTTCTGCAACGCCACCTGTGGGTCGACCTCTCACCAGCTTCTGTGTCTCTGCC
ACTCATATCGACAAGGATCCCTTCGTCACTCCCTCGCACCAGCCTGGTACCCGGCTGTCCCCGACTGCGTCGACC
TTCAGCCCATTTTCGGCATCTCTTAAAGTTGGTCGGGCGTTTGACGCTGCTCCTATCGCCGCTGCACTGAGCAGC
GACTTGGGCTTGTCTCGACATCTGCATGTATCCTCTTCCGCTCACTTGTCCGTGACTGAGGTCAATGCTTGGCTG
AGTGAGTTAGAGGCTCGCGGTGATCCTCCTTGCGGAGCTCGCTTCTCAGACTCATTGGACGGCCAAGTTTGTCTT
CACTTCTCGGATATTCGAGATGCACGTTCTACGATTGCCAGCGCACGTCATGCGGTAAAAGACTGGAAGGTCGAA
TATCTCGATCCATCCCAGCTAGCCAAGTACGGCTCGCCTTGTCGAGATTCAAAGCGATGCTCAAGTGGTCAAGTG
GATGTTCTTGCTGCTGTCCCACAGGACACTTCACTCGATGTGATCCAAGCCATGGAGGCAGTTCAGAGGCTTCTC
CAATGCAATGGGCGCCTTTTCGCATTTGTCAGGCGATCTACATTTCCAAACGGATCTTTCAAGGCCATGGCGGAG
TTCTGTGATGCGAATGCTGCGGAACTGGCAGCTTCGAGCTTGGGAAATATCATCACGTCAGAGGGCATTCATCTT
CTCGTCTCCCCACACCTGGTTGAATTATCGGACGGTTCTGGCGTCATGGAGGCATTCCAAAGCCTGTCCATGGGC
AGAGGTCGGAGCGGTGTAGACCAGCATCAAGCAGCACTTGACACTAGTGCATCGAGGCTCGCAGGGCCTATGGAC
ATGAGAATTCACCCCACCTTTGCCATGTACCCGCTCATGTTTCAACCACAGTTTGCTGCGGCTCCGACAGGAATG
TCCTATCTACTGGATTCATTTATTCCCTCTGGAGCCCAGGGCCCCATGACTCCCATGGCACCGGTCTCGCCATCA
TACTCGGTCGCGGGCCCGCTTTACCACACGCCTCCGTCCCCGGCTCTGACGTCCCAAAACAGTTTCAGTCCATCT
AGATCGCTCACAGACTTTGGTAGGTCGGACGCTCGAAGGCAGCACGCGATGCGCATCAACAGGTCTCCGTACCAT
AATGTGGCGAGCCATCACAACCATGTTGATATTCTTCGGATTCGAGACGGTATAGATGTTCGTACCACAATAATG
TTGCGCAATATTCCCAATAAGGTTGATCAGGCGATGCTTAAGCGAATAATTGATGAATCAAGCTGGGGCAAATAC
GATTTCATGTACTTACGCATTGACTTTGCTAATGACTGCAACGTTGGCTATGCATTTATCAACTTCGTTGACCCA
CTTGACATTATCGACTTTGTGGATGCCAGGGGCAACCAGCGATGGAACTGCTTTAAGAGCGACAAAGTAGCAGAG
ATATCTTATGCAACCATACAAGGCAAGGACTGTCTCGTCCAGAAATTTCGAAATAGCTCTGTAATGCTTGAGGCA
CCTCATTATCGACCAAAGCTGTACTTCACTTCAAATGGCCCCATGCCAGAGTTGGCCGGCCAAGAAGAGCCATTT
CCAGAGCCAGACAACCAGTCCAAAATGAAAAGAAGTTGCGAGAACGCGGAGCATGTCGGCCTGTTCACCCCCAAT
GCAGGACAGCACTTTCGTGACGAGCAGCGACGTCGACGCTCACAATATGACAGAGGCACTCGACTTGCGGCCCTC
GAAGAATACGACTACGAAACAGCTATCCAGCACCTCTACGGCACGCCAACATAA
Transcript >OphauG2|7951
ATGTACTTCCTGCCTCAATACAGGTACCTGGGTCTTCCTGCCTGCCTCACCTTGTCGAAGCTGATCCTATCCAGC
CTGTGCCCTGGCCTCTTGTTTTTTCCTCACCTTGTCCTTACCATAGACTCTTGCTCACCTACCTCACACTCTTGT
GTACGGGCCTTCTTCCTGCTATCAGGGGTGGAAAAGCAGGTAGTAGGCTTGTCGTCTTCGTCTTGCTACTGCTGT
GTCACTGCTGTCATGGCCCAAGTTCGGGATCGCGATAATCCATCGTCGCCGAGATCCTCGTGCGGTGCCGCCGAC
TCTTTCAAGGGCACACCAGAGACACGTTTGACAGCCTTTTCTCCCGAAGATGGCTCGACCAAGTCATCTAAGCTT
CTACATGGACTTGCCCGCTCCGCTTCTGCAACGCCACCTGTGGGTCGACCTCTCACCAGCTTCTGTGTCTCTGCC
ACTCATATCGACAAGGATCCCTTCGTCACTCCCTCGCACCAGCCTGGTACCCGGCTGTCCCCGACTGCGTCGACC
TTCAGCCCATTTTCGGCATCTCTTAAAGTTGGTCGGGCGTTTGACGCTGCTCCTATCGCCGCTGCACTGAGCAGC
GACTTGGGCTTGTCTCGACATCTGCATGTATCCTCTTCCGCTCACTTGTCCGTGACTGAGGTCAATGCTTGGCTG
AGTGAGTTAGAGGCTCGCGGTGATCCTCCTTGCGGAGCTCGCTTCTCAGACTCATTGGACGGCCAAGTTTGTCTT
CACTTCTCGGATATTCGAGATGCACGTTCTACGATTGCCAGCGCACGTCATGCGGTAAAAGACTGGAAGGTCGAA
TATCTCGATCCATCCCAGCTAGCCAAGTACGGCTCGCCTTGTCGAGATTCAAAGCGATGCTCAAGTGGTCAAGTG
GATGTTCTTGCTGCTGTCCCACAGGACACTTCACTCGATGTGATCCAAGCCATGGAGGCAGTTCAGAGGCTTCTC
CAATGCAATGGGCGCCTTTTCGCATTTGTCAGGCGATCTACATTTCCAAACGGATCTTTCAAGGCCATGGCGGAG
TTCTGTGATGCGAATGCTGCGGAACTGGCAGCTTCGAGCTTGGGAAATATCATCACGTCAGAGGGCATTCATCTT
CTCGTCTCCCCACACCTGGTTGAATTATCGGACGGTTCTGGCGTCATGGAGGCATTCCAAAGCCTGTCCATGGGC
AGAGGTCGGAGCGGTGTAGACCAGCATCAAGCAGCACTTGACACTAGTGCATCGAGGCTCGCAGGGCCTATGGAC
ATGAGAATTCACCCCACCTTTGCCATGTACCCGCTCATGTTTCAACCACAGTTTGCTGCGGCTCCGACAGGAATG
TCCTATCTACTGGATTCATTTATTCCCTCTGGAGCCCAGGGCCCCATGACTCCCATGGCACCGGTCTCGCCATCA
TACTCGGTCGCGGGCCCGCTTTACCACACGCCTCCGTCCCCGGCTCTGACGTCCCAAAACAGTTTCAGTCCATCT
AGATCGCTCACAGACTTTGGTAGGTCGGACGCTCGAAGGCAGCACGCGATGCGCATCAACAGGTCTCCGTACCAT
AATGTGGCGAGCCATCACAACCATGTTGATATTCTTCGGATTCGAGACGGTATAGATGTTCGTACCACAATAATG
TTGCGCAATATTCCCAATAAGGTTGATCAGGCGATGCTTAAGCGAATAATTGATGAATCAAGCTGGGGCAAATAC
GATTTCATGTACTTACGCATTGACTTTGCTAATGACTGCAACGTTGGCTATGCATTTATCAACTTCGTTGACCCA
CTTGACATTATCGACTTTGTGGATGCCAGGGGCAACCAGCGATGGAACTGCTTTAAGAGCGACAAAGTAGCAGAG
ATATCTTATGCAACCATACAAGGCAAGGACTGTCTCGTCCAGAAATTTCGAAATAGCTCTGTAATGCTTGAGGCA
CCTCATTATCGACCAAAGCTGTACTTCACTTCAAATGGCCCCATGCCAGAGTTGGCCGGCCAAGAAGAGCCATTT
CCAGAGCCAGACAACCAGTCCAAAATGAAAAGAAGTTGCGAGAACGCGGAGCATGTCGGCCTGTTCACCCCCAAT
GCAGGACAGCACTTTCGTGACGAGCAGCGACGTCGACGCTCACAATATGACAGAGGCACTCGACTTGCGGCCCTC
GAAGAATACGACTACGAAACAGCTATCCAGCACCTCTACGGCACGCCAACATAA
Gene >OphauG2|7951
ATGTACTTCCTGCCTCAATACAGGTACCTGGGTCTTCCTGCCTGCCTCACCTTGTCGAAGCTGGTAAGTACTCCC
CTCCTTATTCACTAGTCCTCGTTCTCGAATTTGCTGTCCACCTTCTCACACGCCCCAGATCCTATCCAGCCTGTG
CCCTGGCCTCTTGTTTTTTCCTCACCTTGTCCTTACCATAGACTCTTGCTCACCTACCTCACACTCTTGTGTACG
GGCCTTCTTCCTGCTATCAGGGGTGGAAAAGCAGGTAGTAGGCTTGTCGTCTTCGTCTTGGTTCGTCTCTCTAGG
GCTGCTTGTGCCAGCCTCATGATAAGTCCAACCTGCCTTCAACCCTGACATATTACCTGTCCTTGCCACAGCTAC
TGCTGTGTCACTGCTGTCATGGCCCAAGTTCGGGATCGCGATAATCCATCGTCGCCGAGATCCTCGTGCGGTGCC
GCCGACTCTTTCAAGGGCACACCAGAGACACGTTTGACAGCCTTTTCTCCCGAAGATGGCTCGACCAAGTCATCT
AAGCTTCTACATGGACTTGCCCGCTCCGCTTCTGCAACGCCACCTGTGGGTCGACCTCTCACCAGCTTCTGTGTC
TCTGCCACTCATATCGACAAGGATCCCTTCGTCACTCCCTCGCACCAGCCTGGTACCCGGCTGTCCCCGACTGCG
TCGACCTTCAGCCCATTTTCGGCATCTCTTAAAGTTGGTCGGGCGTTTGACGCTGCTCCTATCGCCGCTGCACTG
AGCAGCGACTTGGGCTTGTCTCGACATCTGCATGTATCCTCTTCCGCTCACTTGTCCGTGACTGAGGTCAATGCT
TGGCTGAGTGTATTCATTGCCTTGATATATTTCCTCGTGACCTTGAAAATGCTGACCAAGCTCGTTACCGCCAGG
AGTTAGAGGCTCGCGGTGATCCTCCTTGCGGAGCTCGCTTCTCAGACTCATTGGACGGCCAAGTTTGTCTTCACT
TCTCGGATATTCGAGATGCACGTTCTACGATTGCCAGCGCACGTCATGCGGTAAAAGACTGGAAGGTCGAATATC
TCGATCCATCCCAGCTAGCCAAGGTGACATTTGCCACCAATGGTTTTGATTCTTAACACGCTACTAACAGACACA
TATCTTTACACTGGGCAGTACGGCTCGCCTTGTCGAGATTCAAAGCGATGCTCAAGTGGTCAAGTGGATGTTCTT
GCTGCTGTCCCACAGGACACTTCACTCGATGTGATCCAAGCCATGGAGGCAGTTCAGAGGCTTCTCCAATGCAAT
GGGCGCCTTTTCGCATTTGTCAGGCGATCTACATTTCCAAACGGATCTTTCAAGGCCATGGCGGAGTTCTGTGAT
GCGAATGCTGCGGAACTGGCAGCTTCGAGCTTGGGAAATATCATCACGTCAGAGGTACCAGCAATTTATTACACG
TTTTTTCATCACTGGAATTTGTTTCCTGACATTTTGTACAGGGCATTCATCTTCTCGTCTCCCCACACCTGGTTG
AATTATCGGACGGTTCTGGCGTCATGGAGGCATTCCAAAGCCTGTCCATGGGCAGAGGTCGGAGCGGTGTAGACC
AGCATCAAGCAGCACTTGACACTAGTGCATCGAGGCTCGCAGGGCCTATGGACATGAGAATTCACCCCACCTTTG
CCATGTACCCGCTCATGTTTCAACCACAGTTTGCTGCGGCTCCGACAGGAATGTCCTATCTACTGGATTCATTTA
TTCCCTCTGGAGCCCAGGGCCCCATGACTCCCATGGCACCGGTCTCGCCATCATACTCGGTCGCGGGCCCGCTTT
ACCACACGCCTCCGTCCCCGGCTCTGACGTCCCAAAACAGTTTCAGTCCATCTAGATCGCTCACAGACTTTGGTA
GGTCGGACGCTCGAAGGCAGCACGCGATGCGCATCAACAGGTCTCCGTACCATAATGTGGCGAGCCATCACAACC
ATGTTGATATTCTTCGGATTCGAGACGGTATAGATGTTCGTACCACAGTATGTCTCACAGTTCACTTATCCTGGT
GGATGAATAAATCGACTCACGTTGCCACTAGATAATGTTGCGCAATATTCCCAATAAGGTTGATCAGGCGATGCT
TAAGCGAATAATTGATGAATCAAGCTGGGGCAAATACGATTTCATGTACTTACGCATTGACTTTGCTAATGACTG
CAAGTTAGTAGCAAACTGTTTCCGTCATCTAGTTTTTCATGGGCTGACTATATTGAAACAGCGTTGGCTATGCAT
TTATCAACTTCGTTGACGTGAGTGCTTGGGCTCCTGCTATTAGATTTGCGCTAATTATTATACAGCCACTTGACA
TTATCGACGTTTGTCTACCTTTTTTTTTACCTGAATACTTGCACAGGCTAACTTTAGCGAAGTTTGTGGATGCCA
GGGGCAACCAGCGATGGTGAGTTCAAGCCCAGCCCTTTATTAAAGATGAGTTTTCAATTAACATGCATAGGAACT
GCTTTAAGAGCGACAAAGTAGCAGAGATATCTTATGCAAGTGAGTCTCTTTGCTGTAATATAATGTAAATTGATG
ACGAACAGAATGCAGCCATACAAGGCAAGGACTGTCTCGTCCAGAAATTTCGAAATAGCTCTGTAATGCTTGAGG
CACCTCATTATCGACCAAAGGTGTGTATATACCGAAGCCCTGGAAGATCCCCCCAAGTGGCTGCTGGCATGCTGA
CAACATGGATGTTCTAGCTGTACTTCACTTCAAATGGCCCCATGCCAGAGTTGGCCGGCCAAGAAGAGCCATTTC
CAGAGCCAGACAACCAGTCCAAAATGAAAAGAAGTTGCGAGAACGCGGAGCATGTCGGCAAGTACTTTGATCAAC
TCGTTTACGTTGCATACCTAGGCAGGACTAACATCATCTAGGCCTGTTCACCCCCAATGCAGGACAGCACTTTCG
TGACGAGCAGCGACGTCGACGCTCACAATATGACAGAGGCACTCGACTTGCGGCCCTCGAAGAATACGACTACGA
AACAGCTATCCAGCACCTCTACGGCACGCCAACATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail