Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7945
Gene name
LocationContig_982:705..2064
Strand-
Gene length (bp)1359
Transcript length (bp)939
Coding sequence length (bp)939
Protein length (aa) 313

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5 3.8E-41 180 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56329|IF2B_SCHPO Probable eukaryotic translation initiation factor 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif212 PE=1 SV=2 116 310 6.0E-65
sp|P09064|IF2B_YEAST Eukaryotic translation initiation factor 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUI3 PE=1 SV=2 129 310 1.0E-62
sp|Q99L45|IF2B_MOUSE Eukaryotic translation initiation factor 2 subunit 2 OS=Mus musculus GN=Eif2s2 PE=1 SV=1 77 312 4.0E-57
sp|P41035|IF2B_RABIT Eukaryotic translation initiation factor 2 subunit 2 OS=Oryctolagus cuniculus GN=EIF2S2 PE=1 SV=1 77 312 7.0E-57
sp|P20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens GN=EIF2S2 PE=1 SV=2 127 312 4.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56329|IF2B_SCHPO Probable eukaryotic translation initiation factor 2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif212 PE=1 SV=2 116 310 6.0E-65
sp|P09064|IF2B_YEAST Eukaryotic translation initiation factor 2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUI3 PE=1 SV=2 129 310 1.0E-62
sp|Q99L45|IF2B_MOUSE Eukaryotic translation initiation factor 2 subunit 2 OS=Mus musculus GN=Eif2s2 PE=1 SV=1 77 312 4.0E-57
sp|P41035|IF2B_RABIT Eukaryotic translation initiation factor 2 subunit 2 OS=Oryctolagus cuniculus GN=EIF2S2 PE=1 SV=1 77 312 7.0E-57
sp|P20042|IF2B_HUMAN Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens GN=EIF2S2 PE=1 SV=2 127 312 4.0E-56
sp|Q5E9D0|IF2B_BOVIN Eukaryotic translation initiation factor 2 subunit 2 OS=Bos taurus GN=EIF2S2 PE=2 SV=1 86 312 7.0E-56
sp|Q5R4T9|IF2B_PONAB Eukaryotic translation initiation factor 2 subunit 2 OS=Pongo abelii GN=EIF2S2 PE=2 SV=1 127 312 2.0E-55
sp|O24473|IF2B_WHEAT Eukaryotic translation initiation factor 2 subunit beta OS=Triticum aestivum PE=1 SV=1 129 308 8.0E-54
sp|Q41969|IF2B_ARATH Eukaryotic translation initiation factor 2 subunit beta OS=Arabidopsis thaliana GN=EMB1401 PE=1 SV=3 124 308 8.0E-52
sp|P41375|IF2B_DROME Eukaryotic translation initiation factor 2 subunit 2 OS=Drosophila melanogaster GN=eIF-2beta PE=1 SV=1 129 312 5.0E-51
sp|Q21230|IF2B_CAEEL Eukaryotic translation initiation factor 2 subunit 2 OS=Caenorhabditis elegans GN=K04G2.1 PE=3 SV=4 157 311 4.0E-50
sp|P55871|IF2B_MALDO Eukaryotic translation initiation factor 2 subunit beta OS=Malus domestica PE=2 SV=2 157 307 3.0E-49
sp|Q54T27|IF2B_DICDI Eukaryotic translation initiation factor 2 subunit 2 OS=Dictyostelium discoideum GN=eif2s2 PE=3 SV=1 143 311 2.0E-48
sp|Q8TWR5|IF2B_METKA Translation initiation factor 2 subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=eif2b PE=3 SV=1 157 297 7.0E-23
sp|C5A2A8|IF2B_THEGJ Translation initiation factor 2 subunit beta OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=eif2b PE=3 SV=1 161 293 1.0E-21
sp|Q9UYR6|IF2B_PYRAB Translation initiation factor 2 subunit beta OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=eif2b PE=3 SV=1 157 293 1.0E-20
sp|O58312|IF2B_PYRHO Translation initiation factor 2 subunit beta OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=eif2b PE=3 SV=1 157 293 2.0E-20
sp|A6UX55|IF2B_META3 Translation initiation factor 2 subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=eif2b PE=3 SV=1 157 296 3.0E-20
sp|Q6M0H3|IF2B_METMP Translation initiation factor 2 subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=eif2b PE=3 SV=1 157 296 3.0E-20
sp|A4FZP0|IF2B_METM5 Translation initiation factor 2 subunit beta OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=eif2b PE=3 SV=1 157 296 4.0E-20
sp|A7I5J0|IF2B_METB6 Translation initiation factor 2 subunit beta OS=Methanoregula boonei (strain 6A8) GN=eif2b PE=3 SV=1 157 293 6.0E-20
sp|A6URT3|IF2B_METVS Translation initiation factor 2 subunit beta OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=eif2b PE=3 SV=1 157 296 7.0E-20
sp|O27958|IF2B_ARCFU Translation initiation factor 2 subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=eif2b PE=3 SV=1 156 296 7.0E-20
sp|Q8U3I5|IF2B_PYRFU Translation initiation factor 2 subunit beta OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=eif2b PE=1 SV=1 157 293 8.0E-20
sp|Q5JIT0|IF2B_THEKO Translation initiation factor 2 subunit beta OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=eif2b PE=3 SV=1 161 293 1.0E-19
sp|A6VIT7|IF2B_METM7 Translation initiation factor 2 subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=eif2b PE=3 SV=1 157 296 1.0E-19
sp|A9A7T1|IF2B_METM6 Translation initiation factor 2 subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=eif2b PE=3 SV=1 157 296 1.0E-19
sp|A0B5K5|IF2B_METTP Translation initiation factor 2 subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=eif2b PE=3 SV=1 176 293 1.0E-19
sp|A3CXJ3|IF2B_METMJ Translation initiation factor 2 subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=eif2b PE=3 SV=1 183 293 3.0E-19
sp|Q8TU91|IF2B_METAC Translation initiation factor 2 subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=eif2b PE=3 SV=1 157 293 4.0E-19
sp|Q8PWV1|IF2B_METMA Translation initiation factor 2 subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=eif2b PE=3 SV=1 157 293 5.0E-19
sp|Q2NHD9|IF2B_METST Translation initiation factor 2 subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=eif2b PE=3 SV=1 157 296 7.0E-19
sp|Q5V323|IF2B_HALMA Translation initiation factor 2 subunit beta OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=eif2b PE=3 SV=1 183 294 1.0E-18
sp|Q3INQ4|IF2B_NATPD Translation initiation factor 2 subunit beta OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=eif2b PE=3 SV=1 155 290 5.0E-18
sp|A2SSW2|IF2B_METLZ Translation initiation factor 2 subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=eif2b PE=3 SV=1 183 293 6.0E-18
sp|Q97W59|IF2B_SULSO Translation initiation factor 2 subunit beta OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=eif2b PE=1 SV=1 157 293 5.0E-17
sp|B0R583|IF2B_HALS3 Translation initiation factor 2 subunit beta OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=eif2b PE=3 SV=1 173 293 7.0E-17
sp|Q9HQ97|IF2B_HALSA Translation initiation factor 2 subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=eif2b PE=3 SV=1 173 293 7.0E-17
sp|Q6L0E6|IF2B_PICTO Translation initiation factor 2 subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=eif2b PE=3 SV=1 157 293 8.0E-17
sp|Q57562|IF2B_METJA Translation initiation factor 2 subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=eif2b PE=1 SV=1 157 296 1.0E-16
sp|A5UKI8|IF2B_METS3 Translation initiation factor 2 subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=eif2b PE=3 SV=1 157 296 2.0E-16
sp|Q974Z6|IF2B_SULTO Translation initiation factor 2 subunit beta OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=eif2b PE=3 SV=2 157 293 4.0E-16
sp|C3N8N2|IF2B_SULIY Translation initiation factor 2 subunit beta OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=eif2b PE=3 SV=1 157 293 7.0E-16
sp|C3NMA3|IF2B_SULIN Translation initiation factor 2 subunit beta OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=eif2b PE=3 SV=1 157 293 7.0E-16
sp|C3MU32|IF2B_SULIM Translation initiation factor 2 subunit beta OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=eif2b PE=3 SV=1 157 293 7.0E-16
sp|C3MK63|IF2B_SULIL Translation initiation factor 2 subunit beta OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=eif2b PE=3 SV=1 157 293 7.0E-16
sp|C4KK87|IF2B_SULIK Translation initiation factor 2 subunit beta OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=eif2b PE=3 SV=1 157 293 7.0E-16
sp|C3N120|IF2B_SULIA Translation initiation factor 2 subunit beta OS=Sulfolobus islandicus (strain M.16.27) GN=eif2b PE=3 SV=1 157 293 7.0E-16
sp|Q9YBR6|IF2B_AERPE Translation initiation factor 2 subunit beta OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=eif2b PE=3 SV=3 153 296 1.0E-15
sp|A4YEI1|IF2B_METS5 Translation initiation factor 2 subunit beta OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=eif2b PE=3 SV=1 157 293 3.0E-15
sp|Q9HKJ3|IF2B_THEAC Translation initiation factor 2 subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=eif2b PE=3 SV=1 165 297 5.0E-15
sp|Q97B05|IF2B_THEVO Translation initiation factor 2 subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=eif2b PE=3 SV=2 165 296 6.0E-14
sp|O27797|IF2B_METTH Translation initiation factor 2 subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=eif2b PE=1 SV=1 157 290 1.0E-13
sp|Q4JA57|IF2B_SULAC Translation initiation factor 2 subunit beta OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=eif2b PE=3 SV=1 157 293 2.0E-13
sp|B1YCG8|IF2B_PYRNV Translation initiation factor 2 subunit beta OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=eif2b PE=3 SV=1 181 293 1.0E-10
sp|A1RUG4|IF2B_PYRIL Translation initiation factor 2 subunit beta OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=eif2b PE=3 SV=1 181 293 1.0E-10
sp|P38431|IF5_YEAST Eukaryotic translation initiation factor 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF5 PE=1 SV=1 183 290 2.0E-10
sp|Q8ZXA6|IF2B_PYRAE Translation initiation factor 2 subunit beta OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=eif2b PE=3 SV=1 174 293 3.0E-10
sp|A4WI40|IF2B_PYRAR Translation initiation factor 2 subunit beta OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=eif2b PE=3 SV=1 157 293 3.0E-10
sp|A3MUE4|IF2B_PYRCJ Translation initiation factor 2 subunit beta OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=eif2b PE=3 SV=1 181 293 6.0E-10
sp|A3DNI8|IF2B_STAMF Translation initiation factor 2 subunit beta OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=eif2b PE=3 SV=1 160 296 2.0E-09
sp|Q22918|IF5_CAEEL Eukaryotic translation initiation factor 5 OS=Caenorhabditis elegans GN=C37C3.2 PE=3 SV=2 183 288 1.0E-08
sp|Q74M98|IF2B_NANEQ Translation initiation factor 2 subunit beta OS=Nanoarchaeum equitans (strain Kin4-M) GN=eif2b PE=3 SV=1 186 293 4.0E-08
sp|Q09689|IF5_SCHPO Probable eukaryotic translation initiation factor 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif5 PE=3 SV=1 183 290 1.0E-07
sp|P48724|IF5_PHAVU Eukaryotic translation initiation factor 5 OS=Phaseolus vulgaris GN=EIF5 PE=2 SV=1 183 288 2.0E-07
sp|Q9VXK6|IF5_DROME Eukaryotic translation initiation factor 5 OS=Drosophila melanogaster GN=eIF5 PE=1 SV=1 183 288 2.0E-07
sp|A1RX59|IF2B_THEPD Translation initiation factor 2 subunit beta OS=Thermofilum pendens (strain Hrk 5) GN=eif2b PE=3 SV=1 155 293 3.0E-07
sp|P55876|IF5_MAIZE Eukaryotic translation initiation factor 5 OS=Zea mays GN=EIF5 PE=2 SV=1 183 288 1.0E-06
sp|Q07205|IF5_RAT Eukaryotic translation initiation factor 5 OS=Rattus norvegicus GN=Eif5 PE=1 SV=1 183 290 9.0E-06
sp|P59325|IF5_MOUSE Eukaryotic translation initiation factor 5 OS=Mus musculus GN=Eif5 PE=1 SV=1 183 290 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003743 translation initiation factor activity Yes
GO:0006413 translational initiation Yes
GO:0003674 molecular_function No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0045182 translation regulator activity No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0008135 translation factor activity, RNA binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7945
MDDQEQVERKSRKSVAFTNEQVVVDADGSVTMISSTDEPKDTAQSHTAPATNDVPPEDAEMDLSLMKKKKKKKKA
DDIEGQDGNDEAAAPADDGGLDLTMKKKKKKKAKDTGDEDDFTAKLKQLDVKDDGAEADDDQGDMDAGTGIWAHD
ETKTIGYSLLLQRFFSQLSQKNPDHALSGTRSYKIPPPQCMREGNRKTVFANIADICKRMKRTEEHVTAYLFAEL
GTNGSVDGSRRLVIKGRFQQKQIENVVRKYIIEYVTCKTCKSPDTELSKGENRLYFITCNNCGSRRSVTAIKTGF
SAQVGKRKKMQG*
Coding >OphauG2|7945
ATGGATGATCAAGAACAAGTCGAACGCAAGTCTCGCAAGTCGGTTGCATTTACCAACGAACAGGTCGTCGTTGAC
GCCGACGGCTCCGTCACCATGATCAGCTCCACGGACGAGCCCAAGGACACTGCTCAGTCGCACACAGCTCCCGCC
ACCAATGATGTGCCACCAGAGGATGCTGAAATGGACTTGTCACTTATGAAGAAGAAAAAGAAGAAGAAGAAGGCG
GATGATATCGAAGGCCAGGATGGAAATGACGAGGCTGCTGCGCCTGCCGACGATGGCGGCCTGGATCTGACTATG
AAGAAGAAGAAGAAGAAGAAGGCAAAGGACACTGGCGACGAAGACGATTTCACGGCCAAGCTCAAGCAGCTCGAT
GTCAAGGATGATGGCGCCGAGGCCGACGATGACCAAGGAGACATGGATGCTGGCACCGGCATCTGGGCCCATGAC
GAGACAAAAACGATTGGCTACAGCTTACTACTCCAGCGCTTCTTTAGCCAACTATCTCAGAAGAACCCCGATCAT
GCTCTCAGTGGTACAAGGAGCTACAAGATCCCTCCGCCTCAATGCATGCGTGAAGGCAACCGCAAAACCGTTTTT
GCTAATATTGCCGACATTTGTAAGCGCATGAAGCGGACAGAGGAGCACGTCACGGCCTATCTTTTTGCCGAGTTG
GGCACCAACGGCTCCGTGGATGGCAGCAGAAGGTTGGTCATCAAGGGTCGCTTCCAGCAAAAACAGATTGAAAAC
GTGGTGAGAAAATACATCATCGAATATGTAACGTGCAAAACGTGCAAATCGCCCGATACGGAGCTCAGCAAGGGC
GAGAACCGTCTCTACTTCATCACTTGCAACAACTGCGGATCTCGACGCAGTGTCACGGCCATCAAAACTGGTTTC
TCGGCCCAGGTGGGCAAGAGAAAAAAGATGCAGGGCTAG
Transcript >OphauG2|7945
ATGGATGATCAAGAACAAGTCGAACGCAAGTCTCGCAAGTCGGTTGCATTTACCAACGAACAGGTCGTCGTTGAC
GCCGACGGCTCCGTCACCATGATCAGCTCCACGGACGAGCCCAAGGACACTGCTCAGTCGCACACAGCTCCCGCC
ACCAATGATGTGCCACCAGAGGATGCTGAAATGGACTTGTCACTTATGAAGAAGAAAAAGAAGAAGAAGAAGGCG
GATGATATCGAAGGCCAGGATGGAAATGACGAGGCTGCTGCGCCTGCCGACGATGGCGGCCTGGATCTGACTATG
AAGAAGAAGAAGAAGAAGAAGGCAAAGGACACTGGCGACGAAGACGATTTCACGGCCAAGCTCAAGCAGCTCGAT
GTCAAGGATGATGGCGCCGAGGCCGACGATGACCAAGGAGACATGGATGCTGGCACCGGCATCTGGGCCCATGAC
GAGACAAAAACGATTGGCTACAGCTTACTACTCCAGCGCTTCTTTAGCCAACTATCTCAGAAGAACCCCGATCAT
GCTCTCAGTGGTACAAGGAGCTACAAGATCCCTCCGCCTCAATGCATGCGTGAAGGCAACCGCAAAACCGTTTTT
GCTAATATTGCCGACATTTGTAAGCGCATGAAGCGGACAGAGGAGCACGTCACGGCCTATCTTTTTGCCGAGTTG
GGCACCAACGGCTCCGTGGATGGCAGCAGAAGGTTGGTCATCAAGGGTCGCTTCCAGCAAAAACAGATTGAAAAC
GTGGTGAGAAAATACATCATCGAATATGTAACGTGCAAAACGTGCAAATCGCCCGATACGGAGCTCAGCAAGGGC
GAGAACCGTCTCTACTTCATCACTTGCAACAACTGCGGATCTCGACGCAGTGTCACGGCCATCAAAACTGGTTTC
TCGGCCCAGGTGGGCAAGAGAAAAAAGATGCAGGGCTAG
Gene >OphauG2|7945
ATGGATGATCAAGTGAGTTTGCCGAAAAAAGCCGAATACGACGTACTTGCTCTAGCTGCTTGTTTTTGCAACGAC
ATGTGGTTGGACCTTGGTCTCTGGGCTCCACTTAATCTCTTCGCTTGCCATGGCTCACTCGCCCCTCCATTTTTC
TGCTTTCCTTTCTCCCCTGCTCGAAGCGACATTCTCCTTCTGTTGGTCCTTTTCTGACTCACAGCCTTCTGCCAC
CTCATCCCTAGCTCAACCCTTGATATTTCCAAAGTCTGTTCTTCCTGCTGGTTGTGGCCATTGTGTGCACAGAAT
CACTGACTTGTTTCTTTCCGCTCAGGAACAAGTCGAACGCAAGTCTCGCAAGTCGGTTGCATTTACCAACGAACA
GGTCGTCGTTGACGCCGACGGCTCCGTCACCATGATCAGCTCCACGGACGAGCCCAAGGACACTGCTCAGTCGCA
CACAGCTCGTACGCCGCCGCTGACTGCCGCCCTGAGTGCCTTTGCTGATGCCTCATTTGAAGCCGCCACCAATGA
TGTGCCACCAGAGGATGCTGAAATGGACTTGTCACTTATGAAGAAGAAAAAGAAGAAGAAGAAGGCGGATGATAT
CGAAGGCCAGGATGGAAATGACGAGGCTGCTGCGCCTGCCGACGATGGCGGCCTGGATCTGACTATGAAGAAGAA
GAAGAAGAAGAAGGCAAAGGACACTGGCGACGAAGACGATTTCACGGCCAAGCTCAAGCAGCTCGATGTCAAGGA
TGATGGCGCCGAGGCCGACGATGACCAAGGAGACATGGATGCTGGCACCGGCATCTGGGCCCATGACGAGACAAA
AACGATTGGCTACAGCTTACTACTCCAGCGCTTCTTTAGCCAACTATCTCAGAAGAACCCCGATCATGCTCTCAG
TGGTACAAGGAGCTACAAGATCCCTCCGCCTCAATGCATGCGTGAAGGCAACCGCAAAACCGTTTTTGCTAATAT
TGCCGACATTTGTAAGCGCATGAAGCGGACAGAGGAGCACGTCACGGCCTATCTTTTTGCCGAGTTGGGCACCAA
CGGCTCCGTGGATGGCAGCAGAAGGTTGGTCATCAAGGGTCGCTTCCAGCAAAAACAGATTGAAAACGTGGTGAG
AAAATACATCAGTGAGTCTCTTGCTCCGCGTGTCTTGGCTGTACGCCTGACTCACCATGTACAGTCGAATATGTA
ACGTGCAAAACGTGCAAATCGCCCGATACGGAGCTCAGCAAGGGCGAGAACCGTCTCTACTTCATCACTTGCAAC
AACTGCGGATCTCGACGCAGTGTCACGGCCATCAAAACTGGTTTCTCGGCCCAGGTGGGCAAGAGAAAAAAGATG
CAGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail