Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7939
Gene name
LocationContig_98:33405..35084
Strand+
Gene length (bp)1679
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09423 PhoD PhoD-like phosphatase 4.9E-70 205 409
PF16655 PhoD_N PhoD-like phosphatase, N-terminal domain 1.1E-27 69 191

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8KRU5|PLD_STRCW Phospholipase D OS=Streptomyces chromofuscus GN=pld PE=1 SV=2 67 408 9.0E-50
sp|P42251|PPBD_BACSU Alkaline phosphatase D OS=Bacillus subtilis (strain 168) GN=phoD PE=1 SV=3 67 408 1.0E-48

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7939
MRHLVALFSLGAAAAALVFDGNLNYASPSRRHASLGIDVELVERRLRKRSLATSSGYQPPSSPKLHFTHGVASGD
PWPQSVILWTRVAPTNESNASEATVNGTAPLYSHETERFIKADAHPICVGWSVYESQGPDGRLPGHLVTGGQTYT
TSDIDYTVKVEATGLSPRTRYLYQFTICGTDTKSPLGRTKTAPTPDDHDVSSLSFAVFSCSNYPNGYFNAYGNAA
RKDQHDYVIHLGDYIYEYNLGGPRAARPSRLLFTLYDYRTRHGQYRSDPDLQLLSQDFAWIPTWDDHEFANNGYR
DGFQGLNNTEDSFLNKGPRVSVDTRKVNAVRSYFEWMPIRQTDLDDGLRVWRSFQMGKLLDLVMVDTRNYDRSIT
SLDWNDHYIDLIRDDPSRTLMGARQENWFYRSLTQ*
Coding >OphauG2|7939
ATGAGGCATCTCGTCGCTCTTTTCAGTCTTGGTGCCGCGGCAGCCGCCCTGGTGTTTGACGGCAATCTCAACTAT
GCCAGCCCGTCGCGCCGCCACGCCAGCCTAGGCATTGATGTTGAGCTTGTCGAGCGACGCCTCAGGAAGCGCTCT
TTGGCCACCAGCAGCGGCTACCAGCCGCCCTCGTCACCCAAGCTGCACTTTACTCATGGCGTCGCGTCTGGGGAC
CCTTGGCCCCAAAGTGTCATTCTCTGGACTCGCGTCGCGCCCACCAACGAATCCAATGCTAGTGAAGCCACTGTC
AACGGAACCGCGCCTCTGTACTCCCACGAAACCGAGCGCTTTATAAAGGCCGATGCTCACCCCATCTGTGTGGGA
TGGAGCGTATATGAGAGCCAAGGTCCCGACGGGAGATTGCCCGGCCACCTCGTCACCGGCGGCCAGACTTATACC
ACGTCTGATATCGACTACACCGTCAAGGTCGAGGCCACGGGACTCAGCCCACGCACCCGCTATCTCTACCAGTTT
ACCATTTGTGGCACCGACACCAAGAGCCCGCTGGGCCGAACCAAGACGGCTCCAACGCCCGACGACCATGATGTT
TCGTCACTCAGCTTTGCCGTCTTTTCCTGCAGCAACTATCCAAACGGCTACTTCAACGCCTACGGCAATGCCGCC
CGCAAGGACCAGCATGACTATGTTATTCATCTCGGCGACTACATCTACGAATATAATCTAGGAGGCCCTCGCGCT
GCGAGGCCCAGTCGCCTTCTCTTTACCCTGTACGACTACCGCACTCGTCACGGCCAGTACCGGTCCGATCCCGAC
CTGCAGCTGCTGTCCCAAGACTTTGCCTGGATCCCAACCTGGGACGATCACGAATTTGCCAATAATGGCTATCGT
GACGGCTTCCAGGGCCTCAACAACACTGAAGACTCCTTTCTCAACAAGGGCCCCAGGGTCAGTGTTGACACGCGC
AAGGTCAATGCTGTCCGCTCCTACTTTGAGTGGATGCCAATCCGCCAAACCGACCTTGACGATGGCCTGCGTGTT
TGGCGTTCGTTCCAAATGGGCAAGCTCTTGGATCTCGTCATGGTTGATACGCGCAACTATGATCGCAGCATAACT
TCACTTGATTGGAACGACCACTATATCGACTTGATTCGGGACGATCCTAGCCGCACTCTTATGGGCGCACGACAG
GAGAACTGGTTCTATCGGTCGCTGACTCAATGA
Transcript >OphauG2|7939
ATGAGGCATCTCGTCGCTCTTTTCAGTCTTGGTGCCGCGGCAGCCGCCCTGGTGTTTGACGGCAATCTCAACTAT
GCCAGCCCGTCGCGCCGCCACGCCAGCCTAGGCATTGATGTTGAGCTTGTCGAGCGACGCCTCAGGAAGCGCTCT
TTGGCCACCAGCAGCGGCTACCAGCCGCCCTCGTCACCCAAGCTGCACTTTACTCATGGCGTCGCGTCTGGGGAC
CCTTGGCCCCAAAGTGTCATTCTCTGGACTCGCGTCGCGCCCACCAACGAATCCAATGCTAGTGAAGCCACTGTC
AACGGAACCGCGCCTCTGTACTCCCACGAAACCGAGCGCTTTATAAAGGCCGATGCTCACCCCATCTGTGTGGGA
TGGAGCGTATATGAGAGCCAAGGTCCCGACGGGAGATTGCCCGGCCACCTCGTCACCGGCGGCCAGACTTATACC
ACGTCTGATATCGACTACACCGTCAAGGTCGAGGCCACGGGACTCAGCCCACGCACCCGCTATCTCTACCAGTTT
ACCATTTGTGGCACCGACACCAAGAGCCCGCTGGGCCGAACCAAGACGGCTCCAACGCCCGACGACCATGATGTT
TCGTCACTCAGCTTTGCCGTCTTTTCCTGCAGCAACTATCCAAACGGCTACTTCAACGCCTACGGCAATGCCGCC
CGCAAGGACCAGCATGACTATGTTATTCATCTCGGCGACTACATCTACGAATATAATCTAGGAGGCCCTCGCGCT
GCGAGGCCCAGTCGCCTTCTCTTTACCCTGTACGACTACCGCACTCGTCACGGCCAGTACCGGTCCGATCCCGAC
CTGCAGCTGCTGTCCCAAGACTTTGCCTGGATCCCAACCTGGGACGATCACGAATTTGCCAATAATGGCTATCGT
GACGGCTTCCAGGGCCTCAACAACACTGAAGACTCCTTTCTCAACAAGGGCCCCAGGGTCAGTGTTGACACGCGC
AAGGTCAATGCTGTCCGCTCCTACTTTGAGTGGATGCCAATCCGCCAAACCGACCTTGACGATGGCCTGCGTGTT
TGGCGTTCGTTCCAAATGGGCAAGCTCTTGGATCTCGTCATGGTTGATACGCGCAACTATGATCGCAGCATAACT
TCACTTGATTGGAACGACCACTATATCGACTTGATTCGGGACGATCCTAGCCGCACTCTTATGGGCGCACGACAG
GAGAACTGGTTCTATCGGTCGCTGACTCAATGA
Gene >OphauG2|7939
ATGAGGCATCTCGTCGCTCTTTTCAGTCTTGGTGCCGCGGCAGCCGCCCTGGTGTTTGACGGCAATCTCAACTAT
GCCAGCCCGTCGCGCCGCCACGCCAGCCTAGGCATTGATGTTGAGCTTGTCGAGCGACGCCTCAGGAAGCGCTCT
TTGGCCACCAGCAGCGGCTACCAGCCGCCCTCGTCACCCAAGCTGCACTTTACTCATGGCGTCGCGTCTGGGGAC
CCTTGGCCCCAAAGTGTCATTCTCTGGACTCGCGTCGCGCCCACCAACGAATCCAATGCTAGTGAAGCCACTGTC
AACGGAACCGCGCCTCTGTACTCCCACGAAACCGAGCGCTTTATAAAGGCCGATGCTCACCCCATCTGTGTGGGA
TGGAGCGTATATGAGAGCCAAGGTCCCGACGGGAGATTGCCCGGCCACCTCGTCACCGGCGGCCAGACTTATACC
ACGTCTGATATCGACTACACCGTCAAGGCAAGCCCATGTGCTCAAGAGGCCAAACTGGCCCCTGGCTAATGGCCC
TGGCATCCAGGTCGAGGCCACGGGACTCAGCCCACGCACCCGCTATCTCTACCAGTTTACCATTTGTGGCACCGA
CACCAAGAGCCCGCTGGGCCGAACCAAGACGGCTCCAACGCCCGACGACCATGATGTTTCGTCACTCAGCTTTGC
CGTCTTTTCCTGCAGCAACTATCGTCAGTGACCCATAATGGTACAGCACAAGCCAAGACTATGCTGAAGACTATG
CTGACGAGCTGCCGCAAAAGCAAACGGCTACTTCAACGCCTACGGCAATGCCGCCCGCAAGGACCAGCATGACTA
TGTTATTCATCTCGGCGACTACATCTACGAATATAATCTAGGAGGCCCTCGCGCTGCGAGGCCCAGTCGCCTTCT
CTTTACCCTGTACGACTACCGCACTCGTCACGGCCAGGTTGTACTCTGTAACCCTCGTGCCTTGAGCATTGCTTC
TTTTGTCGCTTGGTGGCTGACGGGAAGCAGTACCGGTCCGATCCCGACCTGCAGCTGCTGTCCCAAGACTTTGCC
TGGATCCCAACCTGGGACGATCACGGTTGGTGAATCCGAAAAAAGCCCTACGCCCCAGGCTTCAAGGGGCTAGAC
TGATGAGTGTCAACCCGTAGAATTTGCCAATAATGGCTATCGTGACGGCTTCCAGGGCCTCAACAACACTGAAGA
CTCCTTTCTCAACAAGGGCCCCAGGGTCAGTGTTGACACGCGCAAGGTCAATGCTGTCCGCTCCTACTTTGAGTG
GATGCCAATCCGGTGGGTTTTGCCCACCAAAACCATCTTGACCAATGCTCATGGACAAGGTAGCCAAACCGACCT
TGACGATGGCCTGCGTGTTTGGCGTTCGTTCCAAATGGGCAAGCTCTTGGATCTCGTCATGGTTGATACGCGCAA
CTATGATCGCAGCATAACTTCACTTGGTGCGAAGCAGAGTTTTGATAGCGAGCCAAAACTCATGAGAACTGATGC
CAAGAGACAGATTGGAACGACCACTATATCGACTTGATTCGGGACGATCCTAGCCGCACTCTTATGGGCGCACGA
CAGGAGAACTGGTTCTATCGGTCGCTGACTCAGTCGCAGGAGCGCGGCGCCACCTGGCGAGTCGTGGGAAACCAA
ATCATTTTTTCCCGTGTTTTTGAAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail