Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|7936
Gene name
LocationContig_98:27426..28203
Strand-
Gene length (bp)777
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999722

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5000
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7936 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1076
Ophiocordyceps camponoti-floridani Ophcf2|01076
Ophiocordyceps kimflemingae Ophio5|5138
Ophiocordyceps subramaniannii Hirsu2|2353

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|7936
MRSLVLAACLCWLAESRPSNLLGVSLGDSNALQNAPVSLQANNDLEDLKHGQLFPPSLDALGPDLEGLDDFWPTL
PPGIDENSLVDSDFPFEAPDSQLGPKIPCQDETCSPIAGPPLPSPPETNSSDATGLGDYMQVTNKWRQNMKLPAF
VHDPQLEADAHGAVANSKKLGHLEHDAFDQVLGVYVDNFEVLLLAWLCELPDLAGVGRDTCKKMVNVEQVVGLDG
KPGSGGHAKAIASTTYTKIGCFRVAEFAGCNLK*
Coding >OphauG2|7936
ATGCGCTCACTTGTTCTAGCAGCTTGCCTTTGCTGGCTCGCCGAATCTCGTCCCTCAAACTTGCTTGGAGTAAGC
CTTGGTGATTCAAATGCTCTCCAAAATGCACCTGTCTCTTTGCAGGCAAACAACGACCTGGAGGACTTGAAACAT
GGCCAACTCTTCCCGCCCTCCTTGGATGCTCTTGGGCCCGACTTGGAGGGCTTGGACGACTTTTGGCCCACTCTT
CCACCCGGCATTGATGAAAACTCTCTTGTCGACTCAGACTTTCCCTTTGAAGCACCCGACTCTCAGTTGGGCCCT
AAAATTCCATGTCAAGACGAAACATGCTCTCCCATTGCCGGCCCTCCTCTACCCAGTCCTCCAGAAACAAACAGC
TCCGATGCAACCGGCCTGGGCGACTACATGCAAGTCACAAACAAATGGCGCCAGAACATGAAGCTGCCCGCCTTT
GTCCATGACCCCCAACTCGAAGCCGATGCCCATGGCGCCGTTGCAAATAGCAAAAAGCTCGGCCACCTGGAACAT
GATGCATTCGACCAGGTGCTTGGTGTCTACGTCGACAACTTTGAAGTATTGCTGCTTGCTTGGCTGTGCGAGCTT
CCCGACCTTGCAGGAGTTGGGAGGGATACGTGTAAGAAAATGGTTAATGTCGAGCAGGTTGTCGGGCTGGATGGG
AAACCTGGCTCGGGGGGGCACGCCAAGGCTATTGCATCTACAACATATACAAAGATTGGATGCTTTAGGGTTGCA
GAGTTTGCAGGGTGCAATTTGAAGTGA
Transcript >OphauG2|7936
ATGCGCTCACTTGTTCTAGCAGCTTGCCTTTGCTGGCTCGCCGAATCTCGTCCCTCAAACTTGCTTGGAGTAAGC
CTTGGTGATTCAAATGCTCTCCAAAATGCACCTGTCTCTTTGCAGGCAAACAACGACCTGGAGGACTTGAAACAT
GGCCAACTCTTCCCGCCCTCCTTGGATGCTCTTGGGCCCGACTTGGAGGGCTTGGACGACTTTTGGCCCACTCTT
CCACCCGGCATTGATGAAAACTCTCTTGTCGACTCAGACTTTCCCTTTGAAGCACCCGACTCTCAGTTGGGCCCT
AAAATTCCATGTCAAGACGAAACATGCTCTCCCATTGCCGGCCCTCCTCTACCCAGTCCTCCAGAAACAAACAGC
TCCGATGCAACCGGCCTGGGCGACTACATGCAAGTCACAAACAAATGGCGCCAGAACATGAAGCTGCCCGCCTTT
GTCCATGACCCCCAACTCGAAGCCGATGCCCATGGCGCCGTTGCAAATAGCAAAAAGCTCGGCCACCTGGAACAT
GATGCATTCGACCAGGTGCTTGGTGTCTACGTCGACAACTTTGAAGTATTGCTGCTTGCTTGGCTGTGCGAGCTT
CCCGACCTTGCAGGAGTTGGGAGGGATACGTGTAAGAAAATGGTTAATGTCGAGCAGGTTGTCGGGCTGGATGGG
AAACCTGGCTCGGGGGGGCACGCCAAGGCTATTGCATCTACAACATATACAAAGATTGGATGCTTTAGGGTTGCA
GAGTTTGCAGGGTGCAATTTGAAGTGA
Gene >OphauG2|7936
ATGCGCTCACTTGTTCTAGCAGCTTGCCTTTGCTGGCTCGCCGAATCTCGTCCCTCAAACTTGCTTGGAGTAAGC
CTTGGTGATTCAAATGCTCTCCAAAATGCACCTGTCTCTTTGCAGGCAAACAACGACCTGGAGGACTTGAAACAT
GGCCAACTCTTCCCGCCCTCCTTGGATGCTCTTGGGCCCGACTTGGAGGGCTTGGACGACTTTTGGCCCACTCTT
CCACCCGGCATTGATGAAAACTCTCTTGTCGACTCAGACTTTCCCTTTGAAGCACCCGACTCTCAGTTGGGCCCT
AAAATTCCATGTCAAGACGAAACATGCTCTCCCATTGCCGGCCCTCCTCTACCCAGTCCTCCAGAAACAAACAGC
TCCGATGCAACCGGCCTGGGCGACTACATGCAAGTCACAAACAAATGGCGCCAGAACATGAAGCTGCCCGCCTTT
GTCCATGACCCCCAACTCGAAGCCGATGCCCATGGCGCCGTTGCAAATAGCAAAAAGCTCGGCCACCTGGAACAT
GATGCATTCGACCAGGTGCTTGGTGTCTACGTCGACAACTTTGAAGTATTGCTGCTTGCTTGGCTGTGCGAGCTT
CCCGACCTTGCAGGAGTTGGGAGGGATACGTGTAAGAAAATGGTTAATGTCGAGCAGGTTGTCGGGCTGGATGGG
AAACCTGGCTCGGGGGGGCACGCCAAGGCTATTGCATCTACAACATATACAAAGATTGGATGCTTTAGGGTTGCA
GAGTTTGCAGGGTGCAATTTGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail